Simon dies at Episode 9
Tip Your Landlord Shirt $21.68 |
UFOs Are A Psyop Shirt $21.68 |
Tip Your Landlord Shirt $21.68 |
Simon dies at Episode 9
Tip Your Landlord Shirt $21.68 |
UFOs Are A Psyop Shirt $21.68 |
Tip Your Landlord Shirt $21.68 |
damn that sucks
How would you describe Betty personality. from before and after?
Determined and borderline obsessive.
Whatever fricked up magic she found turned her into a femcel
I unironically liked crazy princess bubblegum.
>Simon has worn the crown
>Finn has worn the crown
>Bubblegum has the crown insanity transferred to her
Looks like Marceline's up to bat to get Crown'd next.
You fricking speedwatchers. The crown doesn't work on vampires.
>You fricking speedwatchers. The crown doesn't work on vampires.
>What is the vampire King
Unless you mean the insanity part, which the second anon didn't imply.
This guy is scary af
Meh, I could take him
Him calling Cake "kitty" was both scary and hot at the same time.
kinda hot, too bad he has chicken feet
I mean, he is a lion thing, so they're both cats. She was kinda into him besides the chicken legs.
Do you think Prismo reality warps himself into his OCs sometimes to bang Cake? I wonder what F&C VK was like before Simon was cured of the crown...
Well anons, do you desire annihilation?
He is kinda hot.
So would you want to get railed by a giant undead lion mad?
You ask that like you don't know the answer
He can penetrate me with his 19 inch stake anyday! (even if he does have chicken legs...)
Elaborate further.
>PLAN A
Human population is declining and he needs a farm
we dont know if mpreg is real of in this universe until we've tried 96422 different ways.(im sure vampire-human hybrids taste just fine.)
>PLAN B
Find prismo and wish that VP was lustfully and passionately in love with me and that if monkey pawned this I would piss in jake's grave(wherever that is)
>PLAN C
>"MAKEMEAVAMPIREMAKEMEAVAMPIREMAKEMEAVAMPIREMAKEMWAVAMPIREMAKEAVAMPIRE"
>"TRAINMETRAINMETRAINMETRAINMETRAINMETRAINME"
>"FALLINLOVEWITHMEFALLINLOVEWITHMEFALLINLOVEWITHMEFALLINLOVEWITHME"(Failproof!!)
It can't be that hard he comes of horny you just gotta talk him right i swear!!!
You'll never have a bird foot against your neck, chocking you unconscious as you hear a dominant mocking laugh.
ANONS, WHY DOES FINN GET TO HAVE EVERYTHING? WHY HIM??? WHYYYY!???
This isn't true right? He is not for reals.. right?
Anons... do you think the Vampire King would passionately and roughly have intercourse with me While calling me "puppy" and "babygirl" in that deep baritone black man voice of his
Instead of killing me and sucking all my blood before tossing me aside as a worthless piece of flesh...?
be honest I can take it.
>"Babygirl" blood concubine
Thats good enough! I can work from there!
I want VK and the Lich to use me please
When are you troons going to write the fic?
I'm just throwing out pervy fish food to all the fish out here.
I find it funny.
I'm tired of pretending to care for gothbatgirl and pinkhitler
This is simply more fun.
I'm always for Pinkhitler™, but the walking Hot Topic is kinda played out.
Interesting. Who would be a good stand-in for VK's... amorous teasing or ravishment?
Simon
>simon
Man people really love self-inserting themselves into a man in his late fifties
You should see the doctor who fandom for that
No self insert, just very fujobrained. Because it's heavily implied VK killed Simon and it made me think "what if he was also raped before being killed"
Then I thought "what if Simon was turned into a vampire and became VK's servant" which would've been a really cool AU.
Maybe someday, a really good fan artist will understand my vision
.....I need to stop crackshipping
>simon attempts ritual to expel vampires completely
>the circle summons vampire king instead
>breaks chains, passes the salt outlines, presses Simon into the wall
>"Does kitty want attention? Or does he want annihilation?"
>"Agh!! Away you beast! I-- I have a stake! I'm going to..I- y-you--
>smashcut go mating press
Simple as that.
>VK buries his large nose, breathing in Simon's musk: garlic, fear, cologne.
>"Ah yes, a fine ingredient. Toxic for lesser things, but for me, mortal," he roared unveiling his teeth.
>"N-no, t-this was a mistake," Simon whimpered. Quickly he tried to bargain with the beast pressing him into the wall. "I know other spells, I can, I can be of-"
>"Hush now child," the lion ordered, right before plunging his maw into Simon's neck, his teeth pressing everything from his neck to his shoulderblade.
>Blood gushed out as Simon struggled. Alas, it was fruitless, for the lion had held his hips in an iron vice, wrapping him with both arms tightly.
I thought Simon was going to be the VK. I thought that would really frick up our Simon mentally, seeing another corrupt evil, but sane Simon in charge.
Yes! Evil vampire dad Simon would've been so cool!
He can be VK's henchman and they're in a secret relationship and both raise Marcy too, idk
Imagine how fricked it would be for "Prime" Simon watching an evil version of himself being in a happy romantic relationship, being close with his adoptive daughter and having a place in the world. That would screw him even more than Winter King.
Prime simon would be devastated
The other two woul be planning the last minute threesome
Imagine he picks up on the pattern that sane Simons with the crown are all amoral or evil.
>Simon started to think that sanity with the crown means evil. Thinking of a way to get out this ice that has him, Fionna, and Cake trapped in.
>His heart sank when he found out that his Marcy, sweet Marcy, as also evil like him, his other him. Floating besides his evil other.
>"There must be some decent thought you have in there, think of Betty!" Simon pleads, c'mon, sure Winter King forgot about Betty but surely this Simon would have to work.
>"Betty?..."
>Simon's eyes sparked up, if can just reach the corrupted soul in this vampiric ice wraith, then he could escape.
>"Yes! Remember her, remember what she meant!"
>The so called Snow Wraith started having doubts, Simon could feel a spark of his soul reaching out.
>"Betty, who. C'mon, Simon, she's just dusts and bones who left" The Star mocks him
>"She didn't leave you..." Simon mutters
>"Besides, I'm always here, right"
>Simon threw up at the sight before
>As his dear marcy passionately kissed his other self
>"I wish I was Ice King"
Well that was my degeneracy quota for the day
I like the Idea of our Simon getting dragged threw different AU and he increasingly more and more angry and wrathful about all the funhouse mirrors of himself and his loved ones. I think he would want Prismo's head and power to clea- correct the different worlds..
perfection
Did you draw this? Great line work.
Nah, this is what you're after
All Starceline appreciators have my respect.
I'm surprised you added the new stuff thought you missed it since I was grinding my gears on it for so long. But yeah always happy when a green I write is enjoyed even if it made me cringe a bit kek
Gunna record more if you continue, actually gunna start archiving a lot of FnC shit since the show is about to end
I just might as I said it's a bit cringe but since people actually enjoyed it I'll try and do more. Yeah this will be our last week but we'll probably stick around until 3 weeks in like most series threads.
Oh based hey man always free to add more if anything me getting to run wild just meant I tried something different and did a footjob section with her breaking poor simon's mind.
but yeah it was fun and got me motivated to really make the green, so it's as much yours as mine happy you enjoyed it.
Can you also more with Finn and Minerva?
I never wrote any finn x minerva, also really was just in the mood for simon x star as the idea was brought up somewhere. Finn x Minerva is a interesting one but If i'm gonna write a green it'll be finishing or adding to the Star Marceline x Simon. Sorry bro
based. I got home too late to add onto. Was anon who responded to some of the beginning stuff. By the time I saw your last green text it was archived. Nice and spicy lol.
I just imgaine Simon getting bite but killing the VK with an ice stake (Lucky hit)
He would be the new VK and he would have the title of "The Magician".
I wonder how different the world would be if there was instead a "good" Vampire King. I imagine VK Simon would keep a coterie of disciples that'll work to store past knowledge and share it with the fledgling inhabitants of the new world and assist with the remains of humanity. Would easily make the closest thing to a "big good" in Ooo.
I love the idea. A prefect world, and Simon is responsible, a hero and martyr.
Yet vampire Simon still longs Betty.
A vampired Betty. A frick slave for 1,000 years sounds rough. She would be mentally gone. Like a trained dog or something..
She would be irate, then plead, then scream for her love, and in the heat of her madness, after being filled day in and day out, she would whimper into Vampire King's main, imagining the lion to be her Simon. The tongue is capable of delusion, but the corrupted heart does not delude: it shows a prostitute who she really is...
Need some art of VK breaking Betty's mind and body..
Why? are you interested in reading my 620 page VKxreader erotic inlustrated novel?
The reader becomes "The Lover" and gets DP'd by VK and Marcy with a bone strap on..
Only if it ends with corruption, transformation, and fleshweaving . I have very particular tastes.
Deal
He already bangs 500 feet tall golbetty so
Yeah he can take it
MEEEE! or cake, BUT MOSTLY MEEEEE!
>first marcyxsimon
>now vk erotica
It was only a matter of time. Well, you certainly will have to make it worth his time. Lest you become apart of his many ossuaries.
>marcyxsimon
Based
Simoline is based
yep especially star x simon
I think that the vampire king has been alive for an extremely long time, and so has ascended beyond "hungie give blud" and gone all the way to "i'm functionally eternal, who the frick cares" and so will absolutely drain you to dust on a moment's notice, but he was probably Dio Brando like three thousand years ago, he might absolutely frick you and not even drain you because to him draining you now or eventually draining you when you're old is essentially the same thing, he's doing the equivalent of leaving his open soda on the counter while going to the bathroom real quick, it's nothing to him.
>"hungie give blud"
That phrase completely removes any power from vampires. Like chanting it as you stake them, giggling as you pierce their heart.
With all the lewds adult Finn is getting, I'm surprised the baragays don't wanna lewd the lion man
Marceline is half human half vampire so she'll go half insane from the magic ice crown
Simon LIVES in F&C Episode 9, give him your energy
simon will win as the ice king until the sun blows up, I just know it.
i was pretty surprised that his son just straight up died
He isn't dead. He is alive.
what? i could've sworn he got, got.
You guys don't understand jokes about life.
life is too much of a joke as is
He's dead dead man, Mr. Fox killed him and stole his job. He's probably going to bang his mom too.
Death should have had a single joke in the Extinction Au episode.
The dead worlds are gonna have a major population problem...
She fricked her student
We could have had it all
Ice King and Spongebob need to fuse together.
ice king will prevail
Are you gonna masturbait anon
He shall prevail
Ice King bros, i kinda don't wanna see Simon dying on a shitty spinoff named after some rule63 cofee AU show. As much as i hate him not even him deserves it.
I do not care.
Yeah. The show SUCKS! Why bother coming here?
I don't know.
I regret sharing that image. You didn't deserve it.
When will we see more of Flynn the human, Jacque the Racoon, Lynn the Person, and Janet the Fox?
Sex with old hags
dare i say based?
Simon becomes a new auditor and goes to fix abnormalities while Fionna chooses to stay by his side thus Cake gets to stay as herself. ends with Fionna holding Simons's hand tenderly
I want to get pegged by butch PB.
considering marcy is dead in both universes, vampire-apocalypse PB and Winter King ex-Candy Queen PB should end up together. The ultimate butch PB and the season-1 ultra-femme pink dress PB should be girlfriends
why didn't Prismo invite Scabby to his parties
>literal 'no fun allowed' guy
>at a party
He'd probably be on Prismo's ass for manifesting objects and such for people at the party cause 'that's not what his powers are for.'
Scabby seems like the type to brag about how much he does for his job while simultaneously complaining about how he doesn’t get enough recognition for it.
He would enforce proper workplace etiquette. No lewd jokes at workplace parties guys!!!!
Imagine inviting the guy who had a melty over you getting the job he wanted. I wouldn't let him hear me with a 10ft pole.
Scarab is the Dwight of the metaphysical world..
That's a really cute Simon
Reminder that prime Billy would OBLITERATE the Lich, the vampires and the Scarab.
Billy is such a jobber.
Counterpoint:
HE FOUGHT A BEAAAAAAAR!!!
Where was he when his tiny gf was being vored by a bear?
>Kicked the epitome of evil and power in the setting down a set of stairs
Everything after that is basically window dressing, nothing could top that and nothing could take that away
Vampworld Finn and Marceline
So Baby Finn and Peptank...
Set off to find a new home...
ttps://www.youtube.com/watch?v=n1AlCxMo6wk&ab_channel=CartoonNetwork
>human child raised by a robot/non human
god i love that trope
>Raised by Punished Bonnie and Robo-Pep, only real friend is the impulsive murderer Marceline
>If he doesn't choose one or the other, he'll either have to run away or let their toxic rivalry either drive him away or tear him in two
>twf it'd most likely be the latter, because Finn is a hero who doesn't give up on his friends, even if they get him killed
As long as Bonnie freely kills crew members I don't think it'll be hard for Finn to choose
I think Simon will "die" consumed once again by the crown.
Maybe he will take the advise from the Winter King and focus his willpower to control the crown.
Also, Betty is trapped or assimilated into an eldritch being that can probably fight back against her. She isn't Betty anymore.
For a series about Simon, why did they forget about this Simon that will be ruined and left depressed by the return of magic?
Simon WILL die because... he's gonna turn into the Ice King..
Ice King. More like, ICE PRINCE.
I like to believe Bmo was actually friends with the Lich because they're literally the only 2 things alive.
I like to think BMO was essentially just talking to himself and projecting onto The Lich, who remained stationary the entire time.
nuh uh
The Lich was probably just giving BMO some of his edgy speeches over and over again while BMO was going
>''lmao that's a nice Joke Jerry''
I feel so sorry for Billy, just when he comes out of his depression, the Lich kills him, wears his body as a flesh suit and made a bear eat his tiny girlfriend alive
HEL YEAH!!
BMO and Jerry became bestest friends and were having all sorts of conversations!!
Jerry really enjoy his time spent with BMO because BMO is the best!!
Until Floppanna and c**t came in and killed the little boy... 🙁
Maybe the Lich did interacted with BMO in some way, but almost surely to boost his own power, either by gathering knowledge, Intel, or manipulating BMO to make it that if anyone ever ventures to Deadworld, he'll lead them to him.
Imagine if the crown takes a part of the unique madness produced by each user. You know how Ice King constantly calls things Guther and acts similar to Evergreen? What if the next person also get that but also have a tendency to kidnap people to the previous wearer's madness imparting to the crown?
BEAST
Farmworld Finn is probably Natty right?
yes, but you need to have at least one kid.
Probably
Farmworld Finn is our original Finn by the way.
They're the same consciousness split in two due to jake's wish. They're both our finn
By that logic Fern is also our original Finn.
The wishes create new realities, not the other way around.
Prismo made a new reality for Finn. Our Finn has been reset and given a new life in the Farmworld.
The other Finn was newly created for Jack's wish.. Prismo isn't a reliable guy, he lies, abuse his power, he let the Lich make a wish.. And he doesn't put the effort into correcting his frick ups.
I prefer him becoming fused with Betty Glob
Simon rather be insane and be with a eldritch betty, which may also be unhinged.
That mindset is really dark, yet it makes gives me a feeling of comfortable nihilism, hiraeth. The idea of putting on the crown reminds me of giving in to the anesthesia, the warm feeling of the drugs running though your veins.
It reminds me of the French saying "folie à deux"
scrolling through the fanart has been a nice past time before bed
I will never understand this ship. Star killed 2 members of her crew and bonnie said she'd never be with her.
well they both hesitate to instantly kill each other, so there has to be somethin there.
Bonnie was born around the time Marcy was a tot, so they might've interacted as childhood friends for a bit before Marcy went on the killing humans spree when she came of age and Bonnie was disgusted by it.
>bonnie said she’d never fall in love with her
And my dad said he’d never smoke another cigarette. The fact she didn’t react with any shock when Simon told her that, just cold denial, says a lot
yeah if Bonnie was really determined to kill her, she’d just stake her at the first opportunity instead of threatening her with “It would be so easy to stake you right now”. She was after the VK’s head, but just to “settle a score” with Star.
When did Star get close enough to suck out her eyeball? Somethin there indeed
She also paused for a moment when Marcy said she could join her. Instead of “Frick off demonspawn”, her answer was “what’s the point?”.
I think it's because they're implied to have been romantic previously, I assume at some point Marceline and the Vampire King had a tiff and she went off to go frick around and eventually spent time with PB and whatever associates she has, and that presumably resulted in Marceline devouring her eyeball and eventually returning home.
link, please.
Will he grow up into a BEAST like his counterparts?
YEAH, Cake was hugging him a lot so the anti magic stuff that they have probably stopped the baby curse and baby Finn will finally grow older, have in mind that baby Finn could actually have manyyy years of experiences in contrast to his appearance (he could even be an adult in a baby body/brain).
tldrl; baby finn is set to be the ultimate finn in terms of combat ability.
AHEM!!!
FRICK SIMON
Looking through the visual dev notes staff have shared, it’s interesting how the Ice Prince design was used for the Winter King before the final version we got was cooked up.
>babyverse is just Prismo monkey’s pawing a BMO wish
BMO is taking a lot of hard Ls lately
Good. He's had it too easy for too long.
I don't believe Prismo's monkey's paws.. He is shit at his job, I bet you that he can't handle magic properly, zero effort.
When it comes to a personal fan project Prismo made a whole universe for his entertainment...
I think Simon would be a better Wish Master.
>I don't believe Prismo's monkey's paws
He LITERALLY tells Jake that the wishes are like Monkey's paws.
I'm saying he doesn't know how to properly control his powers.. The Monkey's paw shit is him making an excuse..
For everyone else it's an inbound existencial threat in the form of an eldritch abomination related to entropy and death. For Stormalong people, it's just Thursday.
Probably obsessed with kidnapping Finn.
>Huntress Blizzard
Frick, that name is genius.
What cause her to wear the crown though?
something to pass the time
I need a source.
https://twitter.com/genuinelybart
IKbros... I don't feel so good...
So next Thursday will have the final two episodes, right? Do you think we’ll get another season after this?
Muto says he's down for it. But it really depends
Probably. I find it fascinating how much more interest it has generated than Distant Lands. Is this the power of weekly releases?
Probably a combination of two episodes airing weekly, nostalgia for the original show, and the multiverse premise feeding a lot of fandom bait
Probably. I'm pretty sure the hype would have died the first week if it was all dumped in one season like netflix does.
We have a lot of fun talking about each release, from theorizing were the show was going, winter king universe and seething over shipping and such. Simping over fionna panties, candy queen and evil marceline and so on. It was a fun ride. But it's time to end.
Yes, we will.
I’d be VERY shocked if there’s a season 2 and not just a different Adventure Time project lol
I agree. Maybe Flame Princess will finally get some love (doubt)
Every time I see them together I have a feeling of dread..
It's going to end as a tragedy guys...
Love will win.
Needs more scenes
Here's a Minerva sketch
Assuming youre that drawfrien
Hey im the BMO fanatic from last thread thanks for the BMO content
He is not, but I am 😀 Thanks for enjoying my content.
Here you go.
I did last thread. I should start using my siganture
haha, nice
Beautiful art. You have a great style..
Could you do Magic Betty in footy pajamas reading the Enchiridion? Maybe add some insane chuckles?
Thank you! Very kind words.
Looks great! Thank you!
I like it
dude wtf, are you an actual storyboard artist? That Enchiridion looks sleek man.
The book cover was copypasted, I chose the easy way out.
It's a okay.
Work smarter not harder besides it's still really well done! Your art is amazing, ProbableButNotComfirmedStoryboarderAnonFrien.
We need a shorter name to call you.
Did you draw that picture?
Someone write a green for this
Finn: Is everything in order?
Minevra: Yes, thank you Finn. I am having quite a fun time.
Simon: Ugh.. *gulp*
Marcy: You're doing great Simon, chill.
Simon will be happy in the end!
his oneitis WILL be cured!
he's gonna frick a whole bunch!
I HOPE they've been fricking him over all season. It's only fair he gets some sort of closure
Simon will be with the glass chick
SHATTER
Can the Lich make you orgasm instantly?
The lich seeks the destruction of all waifus' ovaries
>Can the Lich make you orgasm instantly?
is that a challenge?
Cum.
ngl I would frick the Lich
Go back to sleep, Jerry
Reminder that PB was built to be cucked
Sauce?
Is this show actually any good? I want to know before I force myself to rewatch 9 seasons of AT.
It makes you realize yours and everyone's existence is spiraling into the void..
If you've watched it before, you shouldn't need to rewatch. It'll come back to you. Maybe just rewatch The Lich 3 parter + Crossover, and some of the Betty eps.
It's peak Adventure Time
if you liked flapjack then you'll love the first season at least
I found Scarab lewds and Scarab x Prismo shipping art....... I think I've seen everything
https://twitter.com/Hancar4/status/1704383956659900917
I just want someone out there to draw VK x Simon
Who cares if simon dies or not
Are they gonna save fionna's world? Are they gonna be able to still go to ooo? Will cake revert to cat once she is back?
Will Simon put a baby in Fionna? Find out next time!
Come on, Simon's story is far more interesting than Fionna's world..
Fionna's world sucks.
Marshall lee and Gum Gary are lame
Ice cream lady queen, lemoncarbs, fionna and cake should blow it up and move to ooo.
Ellis P. and LSP should make out at the end
I know a real life Ellis.. It is really surreal, he looks and sounds like the fricking character..
I am watching this series solely for Simon. He's the best character and I seriously couldn't care less about the rule 63 fanfics made by Prismo.
I like his impact but as a dude he bores me. Never liked dweebs with glasses
….lewd
You know what would be a cool fanfic? The aftermath of Minerva alone on the island in Deathworld. Many years from F&C, she will dream, forget, and faintly remember her son trapped in a synthetic prison. Imagine her formulating new, machine-based organisms in response to all protein-based life dying without a trace. Imagine the new horrors she could achieve as she subconsciously remembers her golden haired baby boy, in a futile attempt to reach out to him, and perhaps, recreate him...
if anyone's ever played Signalis or Soma, something like that.
The little people ep was really fun. I wish it wasn't so short, I wanted to see Finn frick around in the sims more.
If this ep was made in a later era they would have fricked around with Bubbline fans so hard
it's still incredibly based of Finn that he made little him cuck his own brother with his pregnant gf
Little orb people are getting it damn, legs crossing and everything
>directly after the scene where Simon decides he doesn’t want to butt in on his not-so-little girl laughing with her gf while doing things to their flesh
It's official; They ruined AT.
>ruined AT.
No.
Not quite yet
>Ooo - magic = farmworld
>Aaa - magic = lo-fi aesthetic 20th centuty world
It's because Simon's brain is shaping Fionna-world, do you watch the show?
I know
Yes
Wait the name of their continent is Aaa??
Kinda? Iirc some official promo materials referred to it as Aaa
I actuallly like that.
You think there's an Eee and Uuu in those fanfics inside the fanfic?
I think it's unofficial.
>the three are flat chested
ugggghhhh so good.
now that you're talking about it what's Fionna's cup size?
Bish C
I'm not entirely used to american cup sizes but that should be an F equivalent in Japanese terms eh?
solid C cup
That fionna looks so cute and breedable
Evil Betty is enticing, Simon will have to fight her to save Fionna & Cake
?t=1816
Anons we were blind.
>Finn shoul've ended wih marcy
>Finn should've ended with PB
>Frinn shouldn've ended with FP
We were all wrong
The real endgame ship was right in front of our eyes all along.
but anon, that's her 3rd dad
That's finn, silly
Marceline gets to watch as she realises VK is lusting for different human bodily fluids
Stakes good ending
>her
I thought that was Finn getting ploughed like a piece of meat.
Is finn a femboy?
>is finn a femboy
Not unless you can time travel or wait for baby finn to grow up. Which is definitely what VK did OP's pic.
Make no mistake, it is.
This is how stakes shouldve ended, but the writters were all cowards
I love her
Simon called them "funky future humans" but in the flashbacks during Islands their attire and housing were pretty contemporary. What happened?
Things got weirder after most if the population died and Minerva took over for whatever reason. Then they dressed and acted like morons.
Minerva forced them to dress like walking traffic cones in the name of safety.
Golb was thiccer than Golbetty. She subtracted mass from him.
So Fionna & Betty are in a even playing field?
Is betty thicc?
No but she got plumpy after getting crazy with magic
Couldn't we have silly fanfics about light-hearted non-sexual stuff?
We had two about BMO and Lich being roomies and one about Minerva dating Simon a while back
Let em have this.
Besides VK is underrated.
Right now it is about vampires, tragedy, fricking, or all of it at once.
YOU'RE GOING TO READ BAD GAY VAMPIRE FANFICTION AND YOU WILL LIKE IT
No, we need more VK posting
He's about to show her his demon back.
We started somethong great tonight
we manifested this into existence with our combined hornymind.
We are basically Prismo.
Who is gonna be out magic human USB and safely store all these images and fics and horny messages into a collage before the thread dies in about 2 days or less?
The collective consciousness of a thousand r34 artists shall keep the magic alive.
look at that gyno, clearly VK has been snacking on some trenbaloney sandwiches.
I should draw something any ideas?
Grown up Babyworld Finn facing against Marcy, who has became queen of vampires.
Didn't she die in the end?
Well it was pretty ambiguous.
Funny enough most likely not seeing as Marceline is either immune to stakes being a demon, or moves her heart using shapeshifting. So either way she is 1000x more likely to survive than PB.
We must have a F&C related kagurabachi meme.
Finn, Jake, and BMO wrapped up in blankets and drinking hot coco
Hey since recent posts
I think you should draw hudson, simon and VK strolling down the kane with child marceline
The three of them are wearing sunglasses and "cool dad" shirts
Hudson and Simon on the sides holding marcy's hands and VK on the back all smiles
Pretend i'm not moronic and typed "down the lane"
I read that as Stroking the kane at first..
Minerva attempting to reach a fuzzy memory of the child she lost to the sea thousands of years ago on a dead world. Her body has experienced many transformations, as a result of her software being overwritten and multiple hardware malfunctions. Her human utopia is now a ruin. Little robots scatter about attempting to rebuild it. Sometimes they reflect their maker's shattered mind and paint, sculpt, and fabricate images of a small baby child long dead.
Why go through so much effort in showing her body?
I think Huntress is going to make it out alive
Why is she tanned?
She constantly shown herself in UV lights while she was sleeping to deter vampires.
A hunter knows how to survive any situation, she played dead. Also why isn't she magic?
Not enough trees and plants in that world
Is that really how her powers work I'd assume she had the ability to grow more. Weird plant/earth isn't an element but I'm sure that's just too basic for AT.
That'd be funny it reminds me of a youtube vid where a guy was pretending to be sleep as he got robbed kek. Imagine him staring and her just sweating and whimpering trying to hold it together poor Huntress got involved in a dumbass plan.
What if he knows and is contemplating what best to do to her?
If they ever make a sequel to The Star it will involve having Huntress being reborn by a magic forest creature. Giving a pseudo backstory for Huntress Wizard.
I’d love it if she wasn’t dead but they haven’t been holding back with showing off corpses
Turned Huntress vs grown up Finn let's gooo.
I mean if dyke fanbase got hatesex bait, why can't we.
damn that sounds hot
More vamp Huntress and with her teasing Finn
Just wishful thinking but a sequel to the Star where a grown up baby Finn fight vampires and it’s reveal that Huntress is still alive but was turned into a vampire by VK as a replacement daughter for Marceline after believing she was killed.
>imagine the hate love relationship with Finn and Huntress.
everyone forgets that marcy has green eyes
Yeah no one ever pays attention to that they're just programmed to think vampire=red. I was pleased to see that the boarders/artists remembered that and showed it in the Star episode.
That goes all the way back to when Marceline first ever appeared.
I like these gals
>show ends in like 3 days
lads what am I supposed to do now
Enjoy the time left
Thirst for VK, complain about bubbleline, compare and rank all the Finns, go on schizo rants about minor details only you noticed about the show, call lich a cuck uhh idk the possibilities are endless
Write lots of fanfiction because you're mad about all the missed potential
I don’t know, im running out of fantasy anime too im looking forward to frieren and goblin slayer and a few other shows but the world of adventure time is 100 times more fun and creative than even my favorite fantasy anime, all you can do is cope until the next mini series
What do you think Marcy and PB are up to during Shermy and Beth's era?
being boring gays like they are any other time
What if its Simon?
The duck thing first appeared in Marcy's debut episode and the telescope has her initials (M.A.) on them
I know. I'm just expecting the unexpected.
Patience trying to do her shit again probably
While the endless decline of time finally saps the pep out the princess
I feel like Patience would look at 1000+ Ooo and just go back to sleep.
You can actually still see her ice sphere in the intro so she's still frozen
Man I love that intro. So many details.
I would hope they do justice to the concept of two teens that have been now been alive for around two milleniums. Get some unsettling mannerisms and perspectives in their personalities born of entropy and repeated loss, instead of the usual “hey dood” cadence of most AT characters. PB can already be freaky but she can be worse
But yeah I’m pretty sure her plans are to expand the CK into space, was that mentioned in the show or am I imagining it
It was but she stopped once tt told her she was harming aliens
I think her plan was to keep candy people safe
And with the help of aunt lolly she build the new gumball guardian
Lolly is in charge while she tries to aid marceline to find PB who was kidnapped by the Ice Thing(who started to kidnap people once it realised it was a thing Ice King did) while also having to keep everyone safe from gibbon the dictator pup
PB is no longer the ruler of the Candy Kingdom by Together Again and it's implied that the humans and candy kingdom merged into a city that eventually fell into ruin
I didnt watch together again or obsidian or whatever other ones there were
So i got a whole lot of junk just not in my brain
Highly recommend at least watching Together Again. It's the real Adventure Time finale, very good.
Honwstly sounds like the right thing to do before fionna and cake end so
Alrighto! I will anon! Get back to you next thread when i randomly bring it up!
> the humans and candy kingdom merged into a city that eventually fell into ruin
I warned you about globalization, PB. I warned you gob
hey what kind of vampire is marceline. is she a toreador or a ventrue or some sort tzimisce, like what
She is a soul sucking demon who got bit by the vampire king
Making her the vampire queen
She basically has every vampire powers and weaknesses AND her dad's soul related powers but that's about it
She can also play the bass
She diablerized like a dozen vampires at this point.
Probably more of a Toreador tho.
Turned AU Betty trying to entrap Simon. That would be an interesting interaction.
did you do that?
Where’s Hudson in vampworld? Is he proud of Marcy, maybe jealous that she’s thriving under VK’s empire instead of his?
Is he dead?
No, he's coming back in the finale along with baby Finn, Prime Finn, and Fionna, and they will slay the Lich with their combined strength like in my favourite animes.
Thats a vampire resistant hat so theres a chance that it was able to save him from those but most likely dead.
Both are piercing attacks so you may be right
Nah, they haven't shied away from showing blood. I think they left it ambiguous on purpose so that someone later can decide if he died or not.
Here's the compilation of PB and Human History Green texts
Bless you. I was the anon who brought up Mengele because I kept imagining a tube with twin peppermint butlers and was wondering how to fit that into the gag.
Simon isn't beating the groomer/cradle robber allegations
>Fionna: Simon! This is bad we had to leave this universe NOW!
>Simon: Oh come on, Fionna. Whatever it is I'm sure we can get thru it if we just tal--
>Cake: THE DISCORD SERVER MESSAGES GOT LEAKED!!
>Simon: we must find and put on my insanity defense crown now!
kek him using his crown as a defense is funny especially since ice king canonlogically declined dating a underage PB.
>Cake:How bad could they be guys? Guys?
>*fionna and Simon look at each other nervously drenched in sweat*
Does he at least frick fionna or betty?
plebbit has some good schizo theory crafting
The frick am I reading?
they just posted this on Reddit with no elaboration. kinda love that
Not too far off.
They are trying to predict that the next episode will feature prismo & scarab's boss. The being opposite of golb, the god of order. They are showing some hints sprinkled in around the show.
The user is saying that the whole thing might be a timeloop that may be finally closed off by the time of Fionna and Cake
All cool but what exactly is the theory
Satan and two of pents imagery means what?
Okay looking at this more I think I kinda get what they're showing a little bit. Mostly seems to be connecting Golb to whatever destroyed the area around the time room. And painting Simon & Betty's journey as a mirror of what happened to Magic Man and Margles. But that picture of a hand at the end is actually pretty interesting, it looks like the same portal Golb came from but it's in Simon's book about Golb.
o yes I love a little Gnosticism in my sadboi cartoons.
Time is a flat circle is it not?
It's reliant on Gnosticism but it's a good take. Years ago people pointed out that in the occult book (which seems to be AT's version of the Lesser Key of Solomon or something akin to that) you can see an entity in the left page next to Golb's page. It's name is Malus and other users pointed out that it looked like Abraxas, a god in Gnostic literature. It's also an ancient latin pronunciation found on late Greco-Roman charms. It has a lot of meanings, but for the purpose of representing Simon, I believe Jung's (psychoanalyst) interpretation reigns supreme: Abraxas represents the driving force of individuation (making things distinct). Making things have a sense of synthesis, maturity, oneness.
I believe the poster paralleled Malus and Golb to Simon and Betty, the latter literally being a part of Golb, and how it's seen as a cosmic balancing act. The infinite snake below it is the Ouroboros. This, along with the way the OP parsed Tart Toter's cryptic message leads me to believe that Simon and Betty are about to finalize the creation of an infinite loop through their desire for one another. Both cannot move on from one another on a cosmic level and are doomed to repeat this cosmic dance ad infinitum.
TL;DR: It's implied Simon and Betty were meant to keep a perpetual time loop. Their tragedy is an all-consuming, self-creating dance. Showrunners have already presented chinks and flaws to their relationship and perhaps this foreshadows how this cosmic dance is toxic to the overall multiverse.
Skipping a lot of reading material from associated esoterica here and going off some of his comments. It's foreshadowed when Prismo talks about the The Time Core where the Clock Titans hit eachother to create time waves, which presumably keep time and space in motion.
Thank you for explaining this for everyone. I thought about posting something similar.
Can someone link to the original reddit post?
You know in most shows I'd say this level of theory crafting and symbolism is too much. But the AT people are actually schizo enough to think about this stuff.
Thanks for this. It's very interesting. It lines up with the description for the next episode that says Simon will travel through time. Does he go back and give himself the crown? A lot to think about.
https://www.reddit.com/r/adventuretime/comments/16r8qg6/addressing_the_larger_backplot_that_has_only_been/
Original post. Can scroll through his history for more info as he probably has a better grasp at other extent references I didn't catch up on.
I was just really interested in Malus the first time they showed him. It made sure to show the viewer they took from Hermetic text as reference material.
Remember that Tart Toter is a gingerbread man and there is a lot of Gingerbread men imagery in the show.
this entire show is just a perpetual soup (heh, get it?) of different writers adding onto old things. I'm just glad someone down the line was either a schizo, an occult practitioner, or just thought esoteric books would look cool aesthetically. either way I'm activated now.
I wonder if they'll reference his speech in the final two eps. It definitely had it's own self contained meaning in that episode where people kept fricking robbing the guy, but I mean now that I saw a schizo rant on it...
As a guy that is into the occult, and esoteric knowledge, I look at the show as a secret love to esoteric belief, Jungian thought, and ancient European Epics.
The world Ooo and the inhabitants is a blatantly inspired by Hieronymus Bosch and other medieval surrealist painters.
>gardenofearthlydelight-pilled
where would you put bubbleline in this portrait?
Of course to the right. That is the best part of the triptych.
honestly that wouldn't be a stretch. I think something bad might actually happen to Simon if that tweet hyping up the sadness in the next eps is to be taken at face value.
oh man if it all comes back around and the simon in the intro flying through the void is something that happens diagetically in like the last episode I am going to lose my mind
Sorry I meant to say "It's implied Simon and Betty were meant to keep a perpetual time loop OR it's a self-perpetuating anomaly that traps the cosmos and time in a loop."
Furthermore, I think Simon being represented by AT's Abraxas is apt. Abraxas is the synthesis of truth and lying, dark and light, it is the demiurge in Jung's myth. It is the manifestation of Pleroma (fullness of divine power, the fullness of the Godhead). When you think about that homosexual gay YA novel going on in Simon's head, you think of them as living within Simon, being wholly connected to Simon to the point where whatever he does changes that world. AT Abraxas can also take on the meaning of synthesizing both Simon and Betty into the loop, as Abraxas himself is defined as being a "wholeness" to Golb-betty's "chaos" or "unreality."
>Immeasurable, like the host of stars, is the number of gods and devils. Every star is a god, and every space occupied by a star is a devil. And the emptiness of the whole is the Pleroma. The activity of the whole is Abraxas; only the unreal opposes him.
Fionna and Cake are implied to be the only thing that can stop the loop through their negation of magical properties.
So if Simon is Abraxas/Malus, who is Golb/Betty again?
just Golb. I don't know if there's a good parallel for Golb outside of Azathoth.
There's a Mario question block inside Golb's head, what's in it
I think some speculated that the block was Prismo's house but not sure.
Golb is possibly a parallel to yaldabaoth
I'm moronic, yeah good point!
Because I'm still working in a way to get the frick out.
From the wiki
>GOLB is similar to the Zoroastrian anti-god Angra Mainyu in that he is a deity-like figure (as opposed to the Satan-like Lich) symbolizing evil and chaos as well as essentially idiotic. Both entities are curiously similar in that the protagonists retrieve loved ones from their bowels: in Zoroastrian myth, Jamshid inserts his fist in Angra Mainyu's anus to retrieve his brother while Jake takes advantage of "Time Adventure" to free Finn, Simon and Betty from GOLB's stomach.
I wonder what this timeline was
With Jake being weirdly winded I have to wonder if this is prime timeline before he dies, but Finn looks bigger than he did in Obsidian
It's before obsidian atleast bc Jake's still alive
That’s what I mean, is it prime timeline pre-Jakedeath or is it an alternate wished timeline where he doesn’t die?
I was kind of assuming the latter before but it’s probably the former
It's OG Jake bc prismo refers to it as the dimension with his" favorite guy"
Why doesnt prismo just talks with the numerous other jakes from universes that are basically copies of the og universe where jake would know about prismo and didnt die yet or whatever
OG Jake was the only Jake that interacted with him/gang out with
Adventure Time is just becoming the adventures of a middle aged museum conservator fighting is mental illness.
Frick this is creepy
The Lich really gives off "analog horror" vibes. LIke you know he knows you are looking at him.
Also the TV static really makes it unnerving.
I hate that he is smiling.
When the lich smiles is because he is cooking up a plan.
I wonder what happened in that dimension after this scene
Stupid theory but what if Scarab becomes Golb, or Glob, or both? He's red and angular. That's all I got.
Glob is definitely his boss but otherwise idk
actually nvm, Glob died, right?
Glob died
You thinking of golb
I don't think Golb is Scarab's boss
Yeah but the other anon was probably confusing golb with glob
Were Prismo and Scabby exes?
>please don't let the f&c finale be as bad and rushed like the adventure time finale
please don't let the fionna and cake finale be as bad and rushed like the adventure time finale
>please don't let the f&c finale be as bad and rushed like the adventure time finale
please don't let the fionna and cake finale be as bad and rushed like the adventure time finale
You'll get what you wished for but the final episode ends on a cliffhanger
>cliffhanger
I hope not
>Simon’s reason to live after losing his world and his Betty was drying a little girl’s tears and protecting her
>He had to leave when he started making her frown
>Current Simon is again finding himself making a little girl frown (the FnC fangirl)
>Even without the crown he’s losing himself
>He’s at the end of his rope and remembers the feeling of being needed and making a girl happy
>But Marcy isn’t a little girl anymore and she’s already happy
>Confiding in her would just deafeat the purpose of what he’s looking for; making her worried would just make him feel worse
>Finally along comes another you girl crying and needing his help
>so he resolves to do the same thing he did for Marcy - wear the crown
>but Marcy never liked that, it never made her happy
>and it will be the same for Fionna, but hopefully this time the girl can succeed in staying his hand
>Little girl
The b***h is at least 25
but yeah realy Simon is a real Dadfu, my guy see a young or emotionally unstable girl in distress or need of guidance and will literally commit suicide/ego death to save them. He's really a bit too loving in a way.
Fionna is so immature that she's practically a child.
True she really is. I get being a failure and bad at "adulting" but for her being in her late 20s super early thirties it's insane. I'm younger than her and have my life put together better and I post on Cinemaphile
Lol never heard that phrase before but yeah basically. When the show started I genuinely thought she was like 19-22 but her being a full ass adult is insane. Like her room, her just quitting her job and being such a prick and schizo before life humbled her.
Tbf she is immature because she got sent into a magic world and feels like she is young and adventurous magic in it
In the normal world she was just a regular loser but still had priorities and attempts
I mean my brother in Cinemaphile she literally stripped in public, and also had a semi mental break down over her dream at work. Like she really was always a bit of a childish tard if anything I could excuse her power fantasy bs if in the real world she wasn't also a bit of a prick to others around her at times.
Okay you got me there.
Her ultimate downfall is that she got sent to 16+ Ooo instead of E for everyone Ooo so she cant just goof around like finn and jake used to
True, also really maybe the joke was girls and cats just suck lol. I feel Cake is a lot more aggressive and schizo than Jake ever was she's well meaning but like a cat she just fricks shit up and is a bit petty. Then fionna was on a power trip so they just both kind of were already not ready for ew. Probably even in F+J ooo they'd have gotten fricked up.
>Now all I see is a young finn and jake beating up fionna and cake for causing trouble.
True, it's basically in the song as it's all about not feeling like ones self also based on all the outfits and references to her losing jobs. she basically hates the grind of having a job she's not interested in and then eventually fails out. Same with how she talks about feeling motivated or like herself of course it is a bit strange only fionna experiences this since everyone else were also magic but seem fine and happy.
>it is a bit strange only fionna experiences this since everyone else were also magic but seem fine and happy.
Cake is ornery and trying to escape the world while she's just a normal cat.
I think they're affected because they're the protagonists of the story that's trapped in Simon's mind.
True I barely counted cake as it seemed less like she felt wrong and more she could see the small distortions that occurred when Simon used the spell. Either way that is a interesting take but yeah if you were the mc of a story and then were forced to be the town b***h you'd probably be suicidal and pathetic too. I mean she's like just a odd job taking cringefail loser girl
Her room and the first intro song just makes me think she has actual depression or some similar severe-lows causing disorder
Major depressive disorder (MDD) Not holding a job is a sign of MDD. Also her sporadic actions and anxiety are also symptoms.
Well aren’t you a good lad
Aimlessness is an epidemic that affects many of your peers and seniors. Always did, frankly.
But back in the day people would embrace the gutter and become a full fledged loser instead of pretending like they’re trying
People did suspect that the reason Fionna is so immature is because Prismo just switched over things without making the proper nuanced changes. Finn was like fourteen yet Prismo made Fionna like eighteen or whatever. That's not even mentioning the whole change of a non magical world either.
Dude calm down. Go to /misc/ or something. You're just being obscenely mad over a cartoon to people who don't really care about that sort of thing. Read a book or something.
A. true you are right but I think with her growing she's proving she had the ability to grow just never the reason. Sometimes trapped in your bubble you can become stagnant even if growth is the only way to break out, it's how hermits and neets and incels happen they need to take that first step but never do then just get worse.
B. don't give them (yous) anon it's what they want
That's pretty much modern women in a nutshell.
Fionna is a 30yo failure to launch millennial.
I hate gays so much it's unreal.
I hate gay/lesbian homosexuals, and I hate that they insert their fricking moronic aberrant degeneracy into cartoons and shows that I like. I hate that every show made for LITTLE KIDS has fricking homosexualS in it! I hate gay people who put their dicks into other man's buttholes! It's dirty and it's disgusting! I'm tired of pretending it's normal when it's not!
STOP TRYING TO NORMALIZE BEING A DEGENERATE! STOP TRYING TO NORMALIZE ABERRANT BEHAVIOR! STOP PUTTING gayS IN CARTOONS!
I hate you and your moldy thoughts
Amon brother!
You down for gay VK-posting later?
VK-posting is actually funny as frick.
Real
kissu
Kissing another man is fricking disgusting btw
actually sickening to see. When I see it in public, I actually wretch. No exaggeration, it's disgusting.
*Malepregs you*
< One time I say a gay in public, I literally wretched and shit my pants. I filled my pants with shit because of all the gayhomos.
People always say frick in the elevator, but I ask: How is it possible to frick in an elevator? You'll only have a few seconds to do it?
You eont frick in them you just make out there
Tho you can just hit all the buttons
can shut up or at least post some VK with your rant
PB and Marcy were canonically normal people before the writers turned them into homosexuals, and now this whole fandom is full of homosexuals and queers. I hate it so much. Why does every character have to be a fricking gay? I could understand if there was like, one gay couple in the show, but why is EVERY CHARACTER GAY OR BI???
If adventure time were releasing for the first time now, Jake would have been a wienersucker, Finn would have been a bisexual (AKA a fence sitting wienersucker) and the show would have been absolute SHIT
>PB and Marcy were canonically normal people before the writers turned them into homosexuals, and now this whole fandom is full of homosexuals and queers. I hate it so much. Why does every character have to be a fricking gay?
This is the brave new world where everyone and everything is at least in some way part of the LGBTQIA+2S spectrum.
LG TV
Name the gay characters that arent BP and marcy and that have a importance to the plot and overall show both by being theyre and by being gay
P.S. my captcha is "GAYVX" which is ironic
This. Subhuman writers make super hot girls into lesbians. Yang, Marceline for example.
Best and beautiful girls supposed to end up with handsome main characters.
Meh. This trend'll pass soon enough I think.
Let homosexuals and troons have their fun for now. Their lives in most cases are fricking pathetic, so seeing degenerates like themselves in cartoons is one of the few joyful things in their sad, miserable existence.
Mad science princess made of candy and demon ultra vampire rockstar, yeah we all know those kind of normalgays
I would have liked to see more of this team
Same.
I just don't understand why we have to force homosexuals into every piece of media? Why can't homosexuals just pretend to be normal people in public, then do their disgusting nasty homosexual shit at home where no one can see them just like the regular heterosexual degenerates do? Homosexuality is like the same thing as having a really disgusting fetish like gaping or scat. It's the same energy. So why do they have to be all proud of it and shit?
You don't see these other bizarre fetishes in cartoons. It's like how there were so many weird foot fetishes in old cartoons, too, and no one fricking liked that shit, but the producers put it in there anyway. Is it the same thing with homosexuals and dikes? God I hate it so much.
Just keep your fricking fetishes behind closed doors and pretend they don't exist like all the other degenerates in the world.
I get it.
It is going to get worse and there is nothing you can do about it unfortunately.... Welcome to the future.
Cease
okay buddy the bit it running dry.
>It's the same energy.
To you because you keep shitting in your brain
Cleanse yourself of dirty bias and actually get to know some people and their feelings
No, this is why I say this, because I know gay people IRL. Lots of them. I use to live in Seattle FFS and before that I lived in PORTLAND so I've known MANY MANY gayS
The majority of people here only care about bubbline cause of the porn
Enough of 'is fionna a virgin'....
Is cake a virgin?Is she neutered?
Prismo undid the neutering so she may have her freak Monochromicorn-Cat offspring
I really hope by the end of the series Fionna becomes more like Finn. Selfless, kind and brave.
What they're doing with her is interesting, but so far she isn't much of hero I don't think. Which just doesn't sit right with me.
She's just a lamer version of Finn, which makes sense since she was raised in a normal mundane environment unlike Finn.
Yeah. Imagine how great it will be to see her change into a hero like Finn.
Heroes aren't born heroes after all. You have to become one.
I think she’s been showing plenty of those qualities, but she also gets scared like how Finn could when he got over his head occasionally. Jake was always there to pull him out of winless situations and that gave him confidence as well. And she and Cake can have the “frick your shit let’s have fun” mentality that FnJ did at times too
I see her cowering here and there after getting herself into shit and I see a Finn that would do the same if he had no experience with fighting. And more than anything I see the similarity in beating themselves up after realizing their behaviour is fricking everything up.
But yeah I want to see where she goes. I really would like a S2 that keeps following her, I’ve grown to like her and Cake. I’d also like to see more of Finn and Jake, a team up would be unfathomably based
Agreed. Team up would be cool to see.
What separates the two (Finn and Fionna) is Fionna's lack of willpower compared to Finn. Finn is fricking relentless, unstoppable when he sets the goal for himself. Which is a main quality that makes him a "hero" guy in our case. And why he's so likable and inspiring.
While Fionna is... well she got absolutely no confidence. The fact that Cake, unlike Jake, provides much less emotional support doesn't help.
That's why I'm very interested in where this all will go in the end. So far Fionna and Cake are nothing like Finn and Jake, which does make them different and it's good, but... I'd honestly like them to become MORE like our OG team. With their own faults and characterisation, but heroes nonetheless.
That's also why I think Simon's going to be alright. What better way to show Fionna finally getting a hold of herself, than saving a day in the end?
Thing is, Finn had Jake who despite certain moments across AT was a generally good role model and like a big brother for Finn. Cake in the other hand is dumb, selfish and a genuinely bad person.
Jake was Finn's big brother and also a dog, Cake was just Fionna's pet and a cat who are selfish greedy creatures.
Do you ever wish your girlfriend would do this to you?
>2012
>Finn is literally me.
>2023
>Simon is literally me.
>2023
>be loner, laughed at by peers
>skinny with brown hair like Simon
>half-slav, probably Turkish as well
>read nag hammadi, Hermetic Philosophy and Creative Alchemy, countless /x/ recommended book lists
>develop disdain for plebs
>tries to manifest cute redhead gf who likes my autistic hobbies
>cries in shower when I have to take meds
He's literally me fr fr. why am I so alone bros...
Simon actually scored
AAAAAAAA
Should had tried some other thing, anything but hemertism or alchemy for that one, pal. I know shit about hermeticism, only that is used by all the frumpy preppy ass motherfrickers of the right pillar.
I know my shit through my own head, not from books. Instinctually and such, my methods are chaotic but they work well, when they work, I'm sure you heard of my type at some point.
I'm pretty sure hermerstism is used more to achieve balance and reject the mundane desires like this ones, so it kinda makes sense it never worked. Alchemy, for I understand now has less to do with what people think it is and more to now with the relation between the metaphysical and the physical, right? Something like that, the path between the astral and the mundane is ether.
You want some cute gf, try the path of the triple goddess with some tang of the dancing goddess. It should work, I think, at least is what my instincts are telling me. They are also telling me is a terrible idea, so you know...
I tried that but the cute wiccan goth chick who sells exotic soaps said she couldn't vibe with my chakras.
I wanna be Simon so bad but best I can do is a depowered Ice King.
Don't...Don't really interact with women about this sort of stuff. Seriously, a lot of them just use as fashion. I don't have access to any of that since I live in the middle of nowhere, I spend weeks memeing like a moron in a discord group full of women to parasite some of their energy using my own methodology to see if I could will one lady that knew some wicca in to existence, and the moment I got one to help me with my shit she complete panicked and left me hanging because "my bad energy". Is all bullshit, anyway, b***h calling me a incubus when I can't even get laid. I swear to god.
And you know, you really don't need a girl to do that, you are technically a girl. just do some research on Anima and animus. Some lucid dreaming and you using it as a portal for the more intimate parts of your subconscious and you actually convincing your feminine part to help you. two years or so I think, I've been trying to the lucid dreaming part but is not exactly easy. I'm taking a lot of creative liberties here btw, so I don't really guarantee anything.
what do your tarot cards say about the last 2 eps?
I have no fricking idea. My grandma played with tarot but she was a total scammer doing hot reading and such. My aunt was a psychic that heard things from static from radios and was pretty famous. I'm pretty sure it was just pareidolia enhanced by female hysteria, but I can check out some youtube static to see if I can listen to something, but I also don't guarantee anything. This sort of thing works much much better with a ritual involved and made sure the ritual was not tainted by a skewed by normies in to stupidity. If you pay the price to make my time worth it.
I personify with Simon because I have obscure esoteric interest and when I try to explain things to people its like talking to a child. I have to try to mimic others to try and get on their level. I have a hard time wanting to engage with other because it is like talking to npcs.
I guess having a high IQ equal suffering..
You’re smothering yourself in your ego. Blinding and deafening with you you you, you and your self-pity and your pride. Do you listen to others first? What is the connecting elements between you and another that will serve as a bridge for your ideas? Do you ask them what their ideas are? People are often hiding some surprises but the unsociable often give up hope because they don’t know how to dig past the surface of small talk or get another to feel comfortable and open up. And of course, are you just infodumping on them and expecting them to feel engaged by your slew of facts and theories that are born from other facts, despite them not having the experience you have had to spark interest? Are you good at replicating your experience for another? Are you an engaging speaker, do you have charisma? People usually aren’t prepared for the conversational equivalent of homework and will feel shut out and slighted if you start talking to them like a child. Yes they’ll encourage your dumping if they see you’re excited but that’s just politeness and kindness. You have to recognize when someone is actually in sync as opposed to just awkwardly holding the door for you.
And intelligent people familiar with esoteric concepts are more common than you think, I have two bosses that love to yarn about such topics. Try to get yourself in environments where you’re likely to meet people who are educated or need to use their brains, (I don’t imagine the common living of Cinemaphile anons, greedy ego business or internet and loneliness poisoned IT is the type of intelligence that will have a growing effect on you)
Humbleness is a mighty virtue that many on Cinemaphile forget. Because they are constantly counselled by the advice of the isolated. They truly start to believe that giving up belief in people’s humanity at the face of any difficulty in connecting to them, is a reasonable or beneficial action. We are the only motherfrickers with inner thought amirite…
I'm charismatic, people like talking to me and I let them build a bridge of ideas. I have a habit of causing others to stop working and start following me, I try and take interest in what they want to share, but it is so vapid, immature, or just mundane...
>People usually aren’t prepared for the conversational equivalent of homework and will feel shut out and slighted if you start talking to them like a child. Yes they’ll encourage your dumping if they see you’re excited but that’s just politeness and kindness. You have to recognize when someone is actually in sync as opposed to just awkwardly holding the door for you.
you hit the nail on the head. I do recognize when other click with me but it is rare, that door is normally closed.
It is hard to say, I blind myself with my ego and I tend to look down on others because I preserve them as empty people..
I love it. From gay vampire shit posts to a discussion about the secret gnostic symbolism in a cartoon.
I can't wait for the massacre of AU Fionna and Cake world. They killed the immortal gameboy baby, they have no limits now.
>the show is now adult
will there be a sex scene?If so who?
20 minutes of hot, uninterrupted babymaking sex episode starring Finn and his wife Huntress Wizard.
how does tree pussy feels like?Bark?
I don't think he's going to sex her when she transforms into a tree. Sounds very unsafe. Splinters and stuff y'know.
I mean she is practically a tree even in human form
C̴̬͔̈́̓́̈́͘͝͠U̴̘̖̹̠̭̘̮͙̖͆̾͋̀̃̌͑͆̇̚M̴̧̢̰̻̙͙̳̬̪̜̥͈̟̬͚̓̀̂̆̍̐̚͘.̴͕̰̳̩̟̝̝̠͎͍̬̈͌̌̋̃̊͂͂͊̃̈́̀͘ͅ
Well there was that one /k/ommando that fricked a tree.
STOP wanting to have sex with the fricking Lich
Sex with Orgalorg instead
I too would love to die of dicky overdose
only one of them can be classified as dicky and that's his daughter.
>watching the show
>mom walks by
>told me that simon is never gonna be happy
>left
>never talked about that anymore
???
>hashtag relatable
no
Simon is gonna GET LAID
BASED
LAID TO REST
BY WHO
BY ME
I've been trying to Lucid dream as Fionna lately so that I can frick Simon in my dream while I am literally Fionna
Simon will be laid, and I shall lay him, in my dreams, with my Fionna puss, and wake up with cum stained sheets, it shall happen
you are more mentally ill than the troony fiona guy
I don't want to become a woman, it's all just a dream anyways, it is over when I wake up and I gotta do the laundry ya know?
How old are you again, anon?
Hope you will do it femanon
So what are Golb and The Lich' relation to the ancient primordials that existed before nothing, are they above them, beneath them, or primordials themselves?
is finn a prime more dial?
I think the wiki said the lich is the embodiment of evil that land on earth billions of years ago from a comet and was awaken by the mushroom war.
Finn is the embodiment of good and destined to fight the lich as his counterpart. So he is more a primordial force of the universe given an human form.
I didn't watched the show this far, so I'm not sure how much this tracks, I was just checking some stuff unrelated to that. I'm not sure how this works with the scholar of golb thing simon said.
Is the Lich going to use the GOLB portal as a way to find more universes with life or was he just there to be a conduit to get out?
Hoping for polarizing kino.
hot
what the frick is wrong with OP
not him, but Adventure Time was truly a mistake