Fionna and Cake

Simon dies at Episode 9

A Conspiracy Theorist Is Talking Shirt $21.68

Unattended Children Pitbull Club Shirt $21.68

A Conspiracy Theorist Is Talking Shirt $21.68

  1. 8 months ago
    Anonymous

    damn that sucks

  2. 8 months ago
    Anonymous

    How would you describe Betty personality. from before and after?

    • 8 months ago
      Anonymous

      Determined and borderline obsessive.

    • 8 months ago
      Anonymous

      Whatever fricked up magic she found turned her into a femcel

  3. 8 months ago
    Anonymous

    I unironically liked crazy princess bubblegum.

    • 8 months ago
      Anonymous

      >Simon has worn the crown
      >Finn has worn the crown
      >Bubblegum has the crown insanity transferred to her
      Looks like Marceline's up to bat to get Crown'd next.

      • 8 months ago
        Anonymous

        When will we see more of Flynn the human, Jacque the Racoon, Lynn the Person, and Janet the Fox?

        You fricking speedwatchers. The crown doesn't work on vampires.

        • 8 months ago
          Anonymous

          >You fricking speedwatchers. The crown doesn't work on vampires.
          >What is the vampire King
          Unless you mean the insanity part, which the second anon didn't imply.

          • 8 months ago
            Anonymous

            This guy is scary af

            • 8 months ago
              Anonymous

              Meh, I could take him

          • 8 months ago
            Anonymous

            This guy is scary af

            Him calling Cake "kitty" was both scary and hot at the same time.

            • 8 months ago
              Anonymous

              kinda hot, too bad he has chicken feet

            • 8 months ago
              Anonymous

              I mean, he is a lion thing, so they're both cats. She was kinda into him besides the chicken legs.

              • 8 months ago
                Anonymous

                kinda hot, too bad he has chicken feet

                Do you think Prismo reality warps himself into his OCs sometimes to bang Cake? I wonder what F&C VK was like before Simon was cured of the crown...

          • 8 months ago
            Anonymous

            Well anons, do you desire annihilation?

          • 8 months ago
            Anonymous

            He is kinda hot.

            • 8 months ago
              Anonymous

              So would you want to get railed by a giant undead lion mad?

              • 8 months ago
                Anonymous

                You ask that like you don't know the answer
                He can penetrate me with his 19 inch stake anyday! (even if he does have chicken legs...)

              • 8 months ago
                Anonymous

                Elaborate further.

              • 8 months ago
                Anonymous

                >PLAN A
                Human population is declining and he needs a farm
                we dont know if mpreg is real of in this universe until we've tried 96422 different ways.(im sure vampire-human hybrids taste just fine.)

                >PLAN B
                Find prismo and wish that VP was lustfully and passionately in love with me and that if monkey pawned this I would piss in jake's grave(wherever that is)

                >PLAN C
                >"MAKEMEAVAMPIREMAKEMEAVAMPIREMAKEMEAVAMPIREMAKEMWAVAMPIREMAKEAVAMPIRE"
                >"TRAINMETRAINMETRAINMETRAINMETRAINMETRAINME"
                >"FALLINLOVEWITHMEFALLINLOVEWITHMEFALLINLOVEWITHMEFALLINLOVEWITHME"(Failproof!!)

                It can't be that hard he comes of horny you just gotta talk him right i swear!!!

              • 8 months ago
                Anonymous

                You'll never have a bird foot against your neck, chocking you unconscious as you hear a dominant mocking laugh.

              • 8 months ago
                Anonymous

                ANONS, WHY DOES FINN GET TO HAVE EVERYTHING? WHY HIM??? WHYYYY!???

              • 8 months ago
                Anonymous

                This isn't true right? He is not for reals.. right?
                Anons... do you think the Vampire King would passionately and roughly have intercourse with me While calling me "puppy" and "babygirl" in that deep baritone black man voice of his
                Instead of killing me and sucking all my blood before tossing me aside as a worthless piece of flesh...?
                be honest I can take it.

              • 8 months ago
                Anonymous

                >"Babygirl" blood concubine

              • 8 months ago
                Anonymous

                Thats good enough! I can work from there!

              • 8 months ago
                Anonymous

                I want VK and the Lich to use me please

              • 8 months ago
                Anonymous

                >"Babygirl" blood concubine

                Thats good enough! I can work from there!

                When are you troons going to write the fic?

              • 8 months ago
                Anonymous

                I'm just throwing out pervy fish food to all the fish out here.

                I find it funny.

              • 8 months ago
                Anonymous

                [...]
                [...]
                When are you troons going to write the fic?

                I'm tired of pretending to care for gothbatgirl and pinkhitler
                This is simply more fun.

              • 8 months ago
                Anonymous

                I'm always for Pinkhitler™, but the walking Hot Topic is kinda played out.

              • 8 months ago
                Anonymous

                [...]
                I'm tired of pretending to care for gothbatgirl and pinkhitler
                This is simply more fun.

                Interesting. Who would be a good stand-in for VK's... amorous teasing or ravishment?

              • 8 months ago
                Anonymous

                Simon

              • 8 months ago
                Anonymous

                >simon
                Man people really love self-inserting themselves into a man in his late fifties

              • 8 months ago
                Anonymous

                You should see the doctor who fandom for that

              • 8 months ago
                Anonymous

                No self insert, just very fujobrained. Because it's heavily implied VK killed Simon and it made me think "what if he was also raped before being killed"
                Then I thought "what if Simon was turned into a vampire and became VK's servant" which would've been a really cool AU.
                Maybe someday, a really good fan artist will understand my vision
                .....I need to stop crackshipping

              • 8 months ago
                Anonymous

                >simon attempts ritual to expel vampires completely
                >the circle summons vampire king instead
                >breaks chains, passes the salt outlines, presses Simon into the wall
                >"Does kitty want attention? Or does he want annihilation?"

              • 8 months ago
                Anonymous

                >"Agh!! Away you beast! I-- I have a stake! I'm going to..I- y-you--
                >smashcut go mating press
                Simple as that.

              • 8 months ago
                Anonymous

                >VK buries his large nose, breathing in Simon's musk: garlic, fear, cologne.
                >"Ah yes, a fine ingredient. Toxic for lesser things, but for me, mortal," he roared unveiling his teeth.
                >"N-no, t-this was a mistake," Simon whimpered. Quickly he tried to bargain with the beast pressing him into the wall. "I know other spells, I can, I can be of-"
                >"Hush now child," the lion ordered, right before plunging his maw into Simon's neck, his teeth pressing everything from his neck to his shoulderblade.
                >Blood gushed out as Simon struggled. Alas, it was fruitless, for the lion had held his hips in an iron vice, wrapping him with both arms tightly.

              • 8 months ago
                Anonymous

                I thought Simon was going to be the VK. I thought that would really frick up our Simon mentally, seeing another corrupt evil, but sane Simon in charge.

              • 8 months ago
                Anonymous

                No self insert, just very fujobrained. Because it's heavily implied VK killed Simon and it made me think "what if he was also raped before being killed"
                Then I thought "what if Simon was turned into a vampire and became VK's servant" which would've been a really cool AU.
                Maybe someday, a really good fan artist will understand my vision
                .....I need to stop crackshipping

                Yes! Evil vampire dad Simon would've been so cool!
                He can be VK's henchman and they're in a secret relationship and both raise Marcy too, idk

              • 8 months ago
                Anonymous

                Imagine how fricked it would be for "Prime" Simon watching an evil version of himself being in a happy romantic relationship, being close with his adoptive daughter and having a place in the world. That would screw him even more than Winter King.

              • 8 months ago
                Anonymous

                Prime simon would be devastated
                The other two woul be planning the last minute threesome

              • 8 months ago
                Anonymous

                Imagine he picks up on the pattern that sane Simons with the crown are all amoral or evil.

              • 8 months ago
                Anonymous

                [...]
                Yes! Evil vampire dad Simon would've been so cool!
                He can be VK's henchman and they're in a secret relationship and both raise Marcy too, idk

                >Simon started to think that sanity with the crown means evil. Thinking of a way to get out this ice that has him, Fionna, and Cake trapped in.
                >His heart sank when he found out that his Marcy, sweet Marcy, as also evil like him, his other him. Floating besides his evil other.
                >"There must be some decent thought you have in there, think of Betty!" Simon pleads, c'mon, sure Winter King forgot about Betty but surely this Simon would have to work.
                >"Betty?..."
                >Simon's eyes sparked up, if can just reach the corrupted soul in this vampiric ice wraith, then he could escape.
                >"Yes! Remember her, remember what she meant!"
                >The so called Snow Wraith started having doubts, Simon could feel a spark of his soul reaching out.
                >"Betty, who. C'mon, Simon, she's just dusts and bones who left" The Star mocks him
                >"She didn't leave you..." Simon mutters
                >"Besides, I'm always here, right"
                >Simon threw up at the sight before
                >As his dear marcy passionately kissed his other self
                >"I wish I was Ice King"

                Well that was my degeneracy quota for the day

              • 8 months ago
                Anonymous

                I like the Idea of our Simon getting dragged threw different AU and he increasingly more and more angry and wrathful about all the funhouse mirrors of himself and his loved ones. I think he would want Prismo's head and power to clea- correct the different worlds..

              • 8 months ago
                Anonymous

                perfection

              • 8 months ago
                Anonymous

                did you do that?

                Did you draw this? Great line work.

              • 8 months ago
                Anonymous

                Nah, this is what you're after

              • 8 months ago
                Anonymous

                perfection

                we manifested this into existence with our combined hornymind.

                everyone forgets that marcy has green eyes

                [...]
                Yes! Evil vampire dad Simon would've been so cool!
                He can be VK's henchman and they're in a secret relationship and both raise Marcy too, idk

                >ruined AT.

                No.

                All Starceline appreciators have my respect.

              • 8 months ago
                Anonymous

                I'm surprised you added the new stuff thought you missed it since I was grinding my gears on it for so long. But yeah always happy when a green I write is enjoyed even if it made me cringe a bit kek

              • 8 months ago
                Anonymous

                Gunna record more if you continue, actually gunna start archiving a lot of FnC shit since the show is about to end

              • 8 months ago
                Anonymous

                I just might as I said it's a bit cringe but since people actually enjoyed it I'll try and do more. Yeah this will be our last week but we'll probably stick around until 3 weeks in like most series threads.

                based. I got home too late to add onto. Was anon who responded to some of the beginning stuff. By the time I saw your last green text it was archived. Nice and spicy lol.

                Oh based hey man always free to add more if anything me getting to run wild just meant I tried something different and did a footjob section with her breaking poor simon's mind.

                but yeah it was fun and got me motivated to really make the green, so it's as much yours as mine happy you enjoyed it.

              • 8 months ago
                Anonymous

                Can you also more with Finn and Minerva?

              • 8 months ago
                Anonymous

                I never wrote any finn x minerva, also really was just in the mood for simon x star as the idea was brought up somewhere. Finn x Minerva is a interesting one but If i'm gonna write a green it'll be finishing or adding to the Star Marceline x Simon. Sorry bro

              • 8 months ago
                Anonymous

                based. I got home too late to add onto. Was anon who responded to some of the beginning stuff. By the time I saw your last green text it was archived. Nice and spicy lol.

              • 8 months ago
                Anonymous

                I just imgaine Simon getting bite but killing the VK with an ice stake (Lucky hit)

                He would be the new VK and he would have the title of "The Magician".

              • 8 months ago
                Anonymous

                I wonder how different the world would be if there was instead a "good" Vampire King. I imagine VK Simon would keep a coterie of disciples that'll work to store past knowledge and share it with the fledgling inhabitants of the new world and assist with the remains of humanity. Would easily make the closest thing to a "big good" in Ooo.

              • 8 months ago
                Anonymous

                I love the idea. A prefect world, and Simon is responsible, a hero and martyr.

                Yet vampire Simon still longs Betty.

              • 8 months ago
                Anonymous

                A vampired Betty. A frick slave for 1,000 years sounds rough. She would be mentally gone. Like a trained dog or something..

              • 8 months ago
                Anonymous

                She would be irate, then plead, then scream for her love, and in the heat of her madness, after being filled day in and day out, she would whimper into Vampire King's main, imagining the lion to be her Simon. The tongue is capable of delusion, but the corrupted heart does not delude: it shows a prostitute who she really is...

              • 8 months ago
                Anonymous

                Need some art of VK breaking Betty's mind and body..

              • 8 months ago
                Anonymous

                Why? are you interested in reading my 620 page VKxreader erotic inlustrated novel?

              • 8 months ago
                Anonymous

                The reader becomes "The Lover" and gets DP'd by VK and Marcy with a bone strap on..

              • 8 months ago
                Anonymous

                Only if it ends with corruption, transformation, and fleshweaving . I have very particular tastes.

              • 8 months ago
                Anonymous

                Deal

                Simon

                He already bangs 500 feet tall golbetty so
                Yeah he can take it

                [...]
                Interesting. Who would be a good stand-in for VK's... amorous teasing or ravishment?

                MEEEE! or cake, BUT MOSTLY MEEEEE!

              • 8 months ago
                Anonymous

                >first marcyxsimon
                >now vk erotica
                It was only a matter of time. Well, you certainly will have to make it worth his time. Lest you become apart of his many ossuaries.

              • 8 months ago
                Anonymous

                >marcyxsimon
                Based

              • 8 months ago
                Anonymous

                Simoline is based

              • 8 months ago
                Anonymous

                yep especially star x simon

              • 8 months ago
                Anonymous

                I think that the vampire king has been alive for an extremely long time, and so has ascended beyond "hungie give blud" and gone all the way to "i'm functionally eternal, who the frick cares" and so will absolutely drain you to dust on a moment's notice, but he was probably Dio Brando like three thousand years ago, he might absolutely frick you and not even drain you because to him draining you now or eventually draining you when you're old is essentially the same thing, he's doing the equivalent of leaving his open soda on the counter while going to the bathroom real quick, it's nothing to him.

              • 8 months ago
                Anonymous

                >"hungie give blud"

                That phrase completely removes any power from vampires. Like chanting it as you stake them, giggling as you pierce their heart.

            • 8 months ago
              Anonymous

              With all the lewds adult Finn is getting, I'm surprised the baragays don't wanna lewd the lion man

        • 8 months ago
          Anonymous

          Marceline is half human half vampire so she'll go half insane from the magic ice crown

  4. 8 months ago
    Anonymous

    Simon LIVES in F&C Episode 9, give him your energy

    • 8 months ago
      Anonymous

      simon will win as the ice king until the sun blows up, I just know it.

      • 8 months ago
        Anonymous

        i was pretty surprised that his son just straight up died

        • 8 months ago
          Anonymous

          He isn't dead. He is alive.

          • 8 months ago
            Anonymous

            what? i could've sworn he got, got.

            • 8 months ago
              Anonymous

              He's dead dead man, Mr. Fox killed him and stole his job. He's probably going to bang his mom too.

              You guys don't understand jokes about life.

              • 8 months ago
                Anonymous

                life is too much of a joke as is

          • 8 months ago
            Anonymous

            He's dead dead man, Mr. Fox killed him and stole his job. He's probably going to bang his mom too.

      • 8 months ago
        Anonymous

        Death should have had a single joke in the Extinction Au episode.

        • 8 months ago
          Anonymous

          The dead worlds are gonna have a major population problem...

          Sex with old hags

          She fricked her student

    • 8 months ago
      Anonymous

      We could have had it all

    • 8 months ago
      Anonymous

      Ice King and Spongebob need to fuse together.

    • 8 months ago
      Anonymous

      IKbros... I don't feel so good...

      ice king will prevail

      • 8 months ago
        Anonymous

        Are you gonna masturbait anon

    • 8 months ago
      Anonymous

      He shall prevail

    • 8 months ago
      Anonymous

      Ice King bros, i kinda don't wanna see Simon dying on a shitty spinoff named after some rule63 cofee AU show. As much as i hate him not even him deserves it.

  5. 8 months ago
    Anonymous

    I do not care.

    • 8 months ago
      Anonymous

      Yeah. The show SUCKS! Why bother coming here?

      • 8 months ago
        Anonymous

        I don't know.

  6. 8 months ago
    Anonymous

    I regret sharing that image. You didn't deserve it.

  7. 8 months ago
    Anonymous

    When will we see more of Flynn the human, Jacque the Racoon, Lynn the Person, and Janet the Fox?

    • 8 months ago
      Anonymous

      Sex with old hags

    • 8 months ago
      Anonymous

      Sex with old hags

      dare i say based?

    • 8 months ago
      Anonymous
  8. 8 months ago
    Anonymous

    Simon becomes a new auditor and goes to fix abnormalities while Fionna chooses to stay by his side thus Cake gets to stay as herself. ends with Fionna holding Simons's hand tenderly

  9. 8 months ago
    Anonymous

    I want to get pegged by butch PB.

    • 8 months ago
      Anonymous

      considering marcy is dead in both universes, vampire-apocalypse PB and Winter King ex-Candy Queen PB should end up together. The ultimate butch PB and the season-1 ultra-femme pink dress PB should be girlfriends

  10. 8 months ago
    Anonymous

    why didn't Prismo invite Scabby to his parties

    • 8 months ago
      Anonymous

      >literal 'no fun allowed' guy
      >at a party
      He'd probably be on Prismo's ass for manifesting objects and such for people at the party cause 'that's not what his powers are for.'

    • 8 months ago
      Anonymous

      Scabby seems like the type to brag about how much he does for his job while simultaneously complaining about how he doesn’t get enough recognition for it.

    • 8 months ago
      Anonymous

      He would enforce proper workplace etiquette. No lewd jokes at workplace parties guys!!!!

    • 8 months ago
      Anonymous

      Imagine inviting the guy who had a melty over you getting the job he wanted. I wouldn't let him hear me with a 10ft pole.

      • 8 months ago
        Anonymous

        Scarab is the Dwight of the metaphysical world..

  11. 8 months ago
    Anonymous

    That's a really cute Simon

  12. 8 months ago
    Anonymous

    Reminder that prime Billy would OBLITERATE the Lich, the vampires and the Scarab.

    • 8 months ago
      Anonymous

      Billy is such a jobber.

      • 8 months ago
        Anonymous

        Counterpoint:
        HE FOUGHT A BEAAAAAAAR!!!

        • 8 months ago
          Anonymous

          Where was he when his tiny gf was being vored by a bear?

      • 8 months ago
        Anonymous

        >Kicked the epitome of evil and power in the setting down a set of stairs
        Everything after that is basically window dressing, nothing could top that and nothing could take that away

  13. 8 months ago
    Anonymous

    Vampworld Finn and Marceline

    • 8 months ago
      Anonymous

      So Baby Finn and Peptank...
      Set off to find a new home...
      ttps://www.youtube.com/watch?v=n1AlCxMo6wk&ab_channel=CartoonNetwork

      • 8 months ago
        Anonymous

        >human child raised by a robot/non human
        god i love that trope

    • 8 months ago
      Anonymous

      >Raised by Punished Bonnie and Robo-Pep, only real friend is the impulsive murderer Marceline
      >If he doesn't choose one or the other, he'll either have to run away or let their toxic rivalry either drive him away or tear him in two
      >twf it'd most likely be the latter, because Finn is a hero who doesn't give up on his friends, even if they get him killed

      • 8 months ago
        Anonymous

        As long as Bonnie freely kills crew members I don't think it'll be hard for Finn to choose

  14. 8 months ago
    Anonymous

    [...]

  15. 8 months ago
    Anonymous
  16. 8 months ago
    Anonymous

    I think Simon will "die" consumed once again by the crown.

    Maybe he will take the advise from the Winter King and focus his willpower to control the crown.

    Also, Betty is trapped or assimilated into an eldritch being that can probably fight back against her. She isn't Betty anymore.

  17. 8 months ago
    Anonymous

    [...]

    For a series about Simon, why did they forget about this Simon that will be ruined and left depressed by the return of magic?

  18. 8 months ago
    Anonymous

    Simon WILL die because... he's gonna turn into the Ice King..

    • 8 months ago
      Anonymous

      Ice King. More like, ICE PRINCE.

  19. 8 months ago
    Anonymous

    I like to believe Bmo was actually friends with the Lich because they're literally the only 2 things alive.

    • 8 months ago
      Anonymous

      I like to think BMO was essentially just talking to himself and projecting onto The Lich, who remained stationary the entire time.

      • 8 months ago
        Anonymous

        nuh uh

      • 8 months ago
        Anonymous

        The Lich was probably just giving BMO some of his edgy speeches over and over again while BMO was going
        >''lmao that's a nice Joke Jerry''

    • 8 months ago
      Anonymous

      I feel so sorry for Billy, just when he comes out of his depression, the Lich kills him, wears his body as a flesh suit and made a bear eat his tiny girlfriend alive

    • 8 months ago
      Anonymous

      nuh uh

      HEL YEAH!!
      BMO and Jerry became bestest friends and were having all sorts of conversations!!
      Jerry really enjoy his time spent with BMO because BMO is the best!!
      Until Floppanna and c**t came in and killed the little boy... 🙁

    • 8 months ago
      Anonymous

      The Lich was probably just giving BMO some of his edgy speeches over and over again while BMO was going
      >''lmao that's a nice Joke Jerry''

      Maybe the Lich did interacted with BMO in some way, but almost surely to boost his own power, either by gathering knowledge, Intel, or manipulating BMO to make it that if anyone ever ventures to Deadworld, he'll lead them to him.

      Imagine if the crown takes a part of the unique madness produced by each user. You know how Ice King constantly calls things Guther and acts similar to Evergreen? What if the next person also get that but also have a tendency to kidnap people to the previous wearer's madness imparting to the crown?

  20. 8 months ago
    Anonymous

    BEAST

    • 8 months ago
      Anonymous

      Farmworld Finn is probably Natty right?

      • 8 months ago
        Anonymous

        yes, but you need to have at least one kid.

      • 8 months ago
        Anonymous

        Probably

    • 8 months ago
      Anonymous

      Farmworld Finn is our original Finn by the way.

      • 8 months ago
        Anonymous

        They're the same consciousness split in two due to jake's wish. They're both our finn

        • 8 months ago
          Anonymous

          By that logic Fern is also our original Finn.

      • 8 months ago
        Anonymous

        The wishes create new realities, not the other way around.

        • 8 months ago
          Anonymous

          Prismo made a new reality for Finn. Our Finn has been reset and given a new life in the Farmworld.

          The other Finn was newly created for Jack's wish.. Prismo isn't a reliable guy, he lies, abuse his power, he let the Lich make a wish.. And he doesn't put the effort into correcting his frick ups.

  21. 8 months ago
    Anonymous

    I prefer him becoming fused with Betty Glob

  22. 8 months ago
    Anonymous

    Simon rather be insane and be with a eldritch betty, which may also be unhinged.

    That mindset is really dark, yet it makes gives me a feeling of comfortable nihilism, hiraeth. The idea of putting on the crown reminds me of giving in to the anesthesia, the warm feeling of the drugs running though your veins.

    It reminds me of the French saying "folie à deux"

  23. 8 months ago
    Anonymous
  24. 8 months ago
    Anonymous

    scrolling through the fanart has been a nice past time before bed

    • 8 months ago
      Anonymous

      I will never understand this ship. Star killed 2 members of her crew and bonnie said she'd never be with her.

      • 8 months ago
        Anonymous

        well they both hesitate to instantly kill each other, so there has to be somethin there.

      • 8 months ago
        Anonymous

        Bonnie was born around the time Marcy was a tot, so they might've interacted as childhood friends for a bit before Marcy went on the killing humans spree when she came of age and Bonnie was disgusted by it.

      • 8 months ago
        Anonymous

        >bonnie said she’d never fall in love with her
        And my dad said he’d never smoke another cigarette. The fact she didn’t react with any shock when Simon told her that, just cold denial, says a lot

        well they both hesitate to instantly kill each other, so there has to be somethin there.

        yeah if Bonnie was really determined to kill her, she’d just stake her at the first opportunity instead of threatening her with “It would be so easy to stake you right now”. She was after the VK’s head, but just to “settle a score” with Star.
        When did Star get close enough to suck out her eyeball? Somethin there indeed

        She also paused for a moment when Marcy said she could join her. Instead of “Frick off demonspawn”, her answer was “what’s the point?”.

      • 8 months ago
        Anonymous

        I think it's because they're implied to have been romantic previously, I assume at some point Marceline and the Vampire King had a tiff and she went off to go frick around and eventually spent time with PB and whatever associates she has, and that presumably resulted in Marceline devouring her eyeball and eventually returning home.

  25. 8 months ago
    Anonymous
    • 8 months ago
      Anonymous

      link, please.

  26. 8 months ago
    Anonymous
    • 8 months ago
      Anonymous
  27. 8 months ago
    Anonymous

    Will he grow up into a BEAST like his counterparts?

    • 8 months ago
      Anonymous

      YEAH, Cake was hugging him a lot so the anti magic stuff that they have probably stopped the baby curse and baby Finn will finally grow older, have in mind that baby Finn could actually have manyyy years of experiences in contrast to his appearance (he could even be an adult in a baby body/brain).
      tldrl; baby finn is set to be the ultimate finn in terms of combat ability.

  28. 8 months ago
    Anonymous

    AHEM!!!

    FRICK SIMON

  29. 8 months ago
    Anonymous

    Looking through the visual dev notes staff have shared, it’s interesting how the Ice Prince design was used for the Winter King before the final version we got was cooked up.

    • 8 months ago
      Anonymous

      >babyverse is just Prismo monkey’s pawing a BMO wish
      BMO is taking a lot of hard Ls lately

      • 8 months ago
        Anonymous

        Good. He's had it too easy for too long.

      • 8 months ago
        Anonymous

        I don't believe Prismo's monkey's paws.. He is shit at his job, I bet you that he can't handle magic properly, zero effort.
        When it comes to a personal fan project Prismo made a whole universe for his entertainment...

        I think Simon would be a better Wish Master.

        • 8 months ago
          Anonymous

          >I don't believe Prismo's monkey's paws
          He LITERALLY tells Jake that the wishes are like Monkey's paws.

          • 8 months ago
            Anonymous

            I'm saying he doesn't know how to properly control his powers.. The Monkey's paw shit is him making an excuse..

  30. 8 months ago
    Anonymous
  31. 8 months ago
    Anonymous

    [...]

    For everyone else it's an inbound existencial threat in the form of an eldritch abomination related to entropy and death. For Stormalong people, it's just Thursday.

  32. 8 months ago
    Anonymous
    • 8 months ago
      Anonymous

      Probably obsessed with kidnapping Finn.

    • 8 months ago
      Anonymous

      >Huntress Blizzard
      Frick, that name is genius.

    • 8 months ago
      Anonymous

      What cause her to wear the crown though?

      • 8 months ago
        Anonymous

        something to pass the time

    • 8 months ago
      Anonymous

      I need a source.

      • 8 months ago
        Anonymous

        https://twitter.com/genuinelybart

  33. 8 months ago
    Anonymous
  34. 8 months ago
    Anonymous

    IKbros... I don't feel so good...

  35. 8 months ago
    Anonymous

    So next Thursday will have the final two episodes, right? Do you think we’ll get another season after this?

    • 8 months ago
      Anonymous

      Muto says he's down for it. But it really depends

    • 8 months ago
      Anonymous

      Probably. I find it fascinating how much more interest it has generated than Distant Lands. Is this the power of weekly releases?

      • 8 months ago
        Anonymous

        Probably a combination of two episodes airing weekly, nostalgia for the original show, and the multiverse premise feeding a lot of fandom bait

      • 8 months ago
        Anonymous

        Probably. I'm pretty sure the hype would have died the first week if it was all dumped in one season like netflix does.

        We have a lot of fun talking about each release, from theorizing were the show was going, winter king universe and seething over shipping and such. Simping over fionna panties, candy queen and evil marceline and so on. It was a fun ride. But it's time to end.

    • 8 months ago
      Anonymous

      Yes, we will.

    • 8 months ago
      Anonymous

      Probably. I find it fascinating how much more interest it has generated than Distant Lands. Is this the power of weekly releases?

      I’d be VERY shocked if there’s a season 2 and not just a different Adventure Time project lol

      • 8 months ago
        Anonymous

        I agree. Maybe Flame Princess will finally get some love (doubt)

  36. 8 months ago
    Anonymous
    • 8 months ago
      Anonymous

      Every time I see them together I have a feeling of dread..

      It's going to end as a tragedy guys...

      • 8 months ago
        Anonymous

        Love will win.

  37. 8 months ago
    Anonymous
  38. 8 months ago
    Anonymous
  39. 8 months ago
    Anonymous

    Needs more scenes

    • 8 months ago
      Anonymous

      Here's a Minerva sketch

      • 8 months ago
        Anonymous

        Assuming youre that drawfrien
        Hey im the BMO fanatic from last thread thanks for the BMO content

        • 8 months ago
          Anonymous

          He is not, but I am 😀 Thanks for enjoying my content.

          [...]

          [...]

          Here you go.

          Did you draw that picture?

          I did last thread. I should start using my siganture

          • 8 months ago
            Anonymous

            haha, nice

          • 8 months ago
            Anonymous

            Beautiful art. You have a great style..

            Could you do Magic Betty in footy pajamas reading the Enchiridion? Maybe add some insane chuckles?

            • 8 months ago
              Anonymous

              Thank you! Very kind words.

              • 8 months ago
                Anonymous

                Looks great! Thank you!

              • 8 months ago
                Anonymous

                I like it

              • 8 months ago
                Anonymous

                dude wtf, are you an actual storyboard artist? That Enchiridion looks sleek man.

              • 8 months ago
                Anonymous

                The book cover was copypasted, I chose the easy way out.

              • 8 months ago
                Anonymous

                It's a okay.
                Work smarter not harder besides it's still really well done! Your art is amazing, ProbableButNotComfirmedStoryboarderAnonFrien.
                We need a shorter name to call you.

      • 8 months ago
        Anonymous

        Did you draw that picture?

      • 8 months ago
        Anonymous

        Someone write a green for this

        • 8 months ago
          Anonymous

          Finn: Is everything in order?
          Minevra: Yes, thank you Finn. I am having quite a fun time.
          Simon: Ugh.. *gulp*
          Marcy: You're doing great Simon, chill.

  40. 8 months ago
    Anonymous
  41. 8 months ago
    Anonymous

    Simon will be happy in the end!
    his oneitis WILL be cured!
    he's gonna frick a whole bunch!

    • 8 months ago
      Anonymous

      I HOPE they've been fricking him over all season. It's only fair he gets some sort of closure

    • 8 months ago
      Anonymous

      Simon will be with the glass chick

      • 8 months ago
        Anonymous

        SHATTER

        • 8 months ago
          Anonymous

          Can the Lich make you orgasm instantly?

          • 8 months ago
            Anonymous

            The lich seeks the destruction of all waifus' ovaries

          • 8 months ago
            Anonymous

            >Can the Lich make you orgasm instantly?
            is that a challenge?

          • 8 months ago
            Anonymous

            Cum.

          • 8 months ago
            Anonymous

            ngl I would frick the Lich

        • 8 months ago
          Anonymous

          Go back to sleep, Jerry

  42. 8 months ago
    Anonymous

    Reminder that PB was built to be cucked

    • 8 months ago
      Anonymous

      Sauce?

  43. 8 months ago
    Anonymous

    Is this show actually any good? I want to know before I force myself to rewatch 9 seasons of AT.

    • 8 months ago
      Anonymous

      It makes you realize yours and everyone's existence is spiraling into the void..

    • 8 months ago
      Anonymous

      If you've watched it before, you shouldn't need to rewatch. It'll come back to you. Maybe just rewatch The Lich 3 parter + Crossover, and some of the Betty eps.

    • 8 months ago
      Anonymous

      It's peak Adventure Time

    • 8 months ago
      Anonymous

      if you liked flapjack then you'll love the first season at least

  44. 8 months ago
    Anonymous

    I found Scarab lewds and Scarab x Prismo shipping art....... I think I've seen everything
    https://twitter.com/Hancar4/status/1704383956659900917
    I just want someone out there to draw VK x Simon

  45. 8 months ago
    Anonymous

    Who cares if simon dies or not
    Are they gonna save fionna's world? Are they gonna be able to still go to ooo? Will cake revert to cat once she is back?

    • 8 months ago
      Anonymous

      Will Simon put a baby in Fionna? Find out next time!

    • 8 months ago
      Anonymous

      Come on, Simon's story is far more interesting than Fionna's world..

    • 8 months ago
      Anonymous

      Fionna's world sucks.
      Marshall lee and Gum Gary are lame
      Ice cream lady queen, lemoncarbs, fionna and cake should blow it up and move to ooo.
      Ellis P. and LSP should make out at the end

      • 8 months ago
        Anonymous

        I know a real life Ellis.. It is really surreal, he looks and sounds like the fricking character..

    • 8 months ago
      Anonymous

      I am watching this series solely for Simon. He's the best character and I seriously couldn't care less about the rule 63 fanfics made by Prismo.

      • 8 months ago
        Anonymous

        I like his impact but as a dude he bores me. Never liked dweebs with glasses

  46. 8 months ago
    Anonymous

    ….lewd

  47. 8 months ago
    Anonymous
  48. 8 months ago
    Anonymous
  49. 8 months ago
    Anonymous

    You know what would be a cool fanfic? The aftermath of Minerva alone on the island in Deathworld. Many years from F&C, she will dream, forget, and faintly remember her son trapped in a synthetic prison. Imagine her formulating new, machine-based organisms in response to all protein-based life dying without a trace. Imagine the new horrors she could achieve as she subconsciously remembers her golden haired baby boy, in a futile attempt to reach out to him, and perhaps, recreate him...

    if anyone's ever played Signalis or Soma, something like that.

  50. 8 months ago
    Anonymous
    • 8 months ago
      Anonymous

      The little people ep was really fun. I wish it wasn't so short, I wanted to see Finn frick around in the sims more.

    • 8 months ago
      Anonymous

      If this ep was made in a later era they would have fricked around with Bubbline fans so hard
      it's still incredibly based of Finn that he made little him cuck his own brother with his pregnant gf

  51. 8 months ago
    Anonymous

    Little orb people are getting it damn, legs crossing and everything
    >directly after the scene where Simon decides he doesn’t want to butt in on his not-so-little girl laughing with her gf while doing things to their flesh

  52. 8 months ago
    Anonymous

    It's official; They ruined AT.

    • 8 months ago
      Anonymous

      >ruined AT.

      No.

    • 8 months ago
      Anonymous

      Not quite yet

  53. 8 months ago
    Anonymous
  54. 8 months ago
    Anonymous

    >Ooo - magic = farmworld
    >Aaa - magic = lo-fi aesthetic 20th centuty world

    • 8 months ago
      Anonymous

      It's because Simon's brain is shaping Fionna-world, do you watch the show?

      • 8 months ago
        Anonymous

        I know

        Wait the name of their continent is Aaa??

        Yes

    • 8 months ago
      Anonymous

      Wait the name of their continent is Aaa??

      • 8 months ago
        Anonymous

        Kinda? Iirc some official promo materials referred to it as Aaa

        • 8 months ago
          Anonymous

          I actuallly like that.
          You think there's an Eee and Uuu in those fanfics inside the fanfic?

      • 8 months ago
        Anonymous

        I think it's unofficial.

  55. 8 months ago
    Anonymous

    >the three are flat chested
    ugggghhhh so good.

    • 8 months ago
      Anonymous

      now that you're talking about it what's Fionna's cup size?

      • 8 months ago
        Anonymous

        Bish C

        • 8 months ago
          Anonymous

          solid C cup

          I'm not entirely used to american cup sizes but that should be an F equivalent in Japanese terms eh?

      • 8 months ago
        Anonymous

        solid C cup

  56. 8 months ago
    Anonymous

    That fionna looks so cute and breedable

  57. 8 months ago
    Anonymous
  58. 8 months ago
    Anonymous

    Evil Betty is enticing, Simon will have to fight her to save Fionna & Cake

    ?t=1816

  59. 8 months ago
    Anonymous

    Anons we were blind.
    >Finn shoul've ended wih marcy
    >Finn should've ended with PB
    >Frinn shouldn've ended with FP
    We were all wrong
    The real endgame ship was right in front of our eyes all along.

    • 8 months ago
      Anonymous

      but anon, that's her 3rd dad

      • 8 months ago
        Anonymous

        That's finn, silly
        Marceline gets to watch as she realises VK is lusting for different human bodily fluids

    • 8 months ago
      Anonymous

      Stakes good ending

    • 8 months ago
      Anonymous

      but anon, that's her 3rd dad

      >her
      I thought that was Finn getting ploughed like a piece of meat.

      • 8 months ago
        Anonymous

        Is finn a femboy?

        • 8 months ago
          Anonymous

          >is finn a femboy
          Not unless you can time travel or wait for baby finn to grow up. Which is definitely what VK did OP's pic.

      • 8 months ago
        Anonymous

        Make no mistake, it is.
        This is how stakes shouldve ended, but the writters were all cowards

  60. 8 months ago
    Anonymous

    I love her

  61. 8 months ago
    Anonymous

    Simon called them "funky future humans" but in the flashbacks during Islands their attire and housing were pretty contemporary. What happened?

    • 8 months ago
      Anonymous

      Things got weirder after most if the population died and Minerva took over for whatever reason. Then they dressed and acted like morons.

      • 8 months ago
        Anonymous

        Minerva forced them to dress like walking traffic cones in the name of safety.

        • 8 months ago
          Anonymous

          Golb was thiccer than Golbetty. She subtracted mass from him.

          • 8 months ago
            Anonymous

            So Fionna & Betty are in a even playing field?

  62. 8 months ago
    Anonymous

    Is betty thicc?

    • 8 months ago
      Anonymous

      No but she got plumpy after getting crazy with magic

  63. 8 months ago
    Anonymous

    Couldn't we have silly fanfics about light-hearted non-sexual stuff?

    • 8 months ago
      Anonymous

      We had two about BMO and Lich being roomies and one about Minerva dating Simon a while back
      Let em have this.
      Besides VK is underrated.

    • 8 months ago
      Anonymous

      Right now it is about vampires, tragedy, fricking, or all of it at once.

    • 8 months ago
      Anonymous

      YOU'RE GOING TO READ BAD GAY VAMPIRE FANFICTION AND YOU WILL LIKE IT

    • 8 months ago
      Anonymous

      No, we need more VK posting

      • 8 months ago
        Anonymous

        He's about to show her his demon back.

      • 8 months ago
        Anonymous

        He's about to show her his demon back.

        Why go through so much effort in showing her body?
        I think Huntress is going to make it out alive

        We started somethong great tonight

        • 8 months ago
          Anonymous

          we manifested this into existence with our combined hornymind.

          • 8 months ago
            Anonymous

            We are basically Prismo.
            Who is gonna be out magic human USB and safely store all these images and fics and horny messages into a collage before the thread dies in about 2 days or less?

            • 8 months ago
              Anonymous

              The collective consciousness of a thousand r34 artists shall keep the magic alive.

              • 8 months ago
                Anonymous

                look at that gyno, clearly VK has been snacking on some trenbaloney sandwiches.

        • 8 months ago
          Anonymous
  64. 8 months ago
    Anonymous

    I should draw something any ideas?

    • 8 months ago
      Anonymous

      Grown up Babyworld Finn facing against Marcy, who has became queen of vampires.

      • 8 months ago
        Anonymous

        Didn't she die in the end?

        • 8 months ago
          Anonymous

          Well it was pretty ambiguous.

        • 8 months ago
          Anonymous

          Funny enough most likely not seeing as Marceline is either immune to stakes being a demon, or moves her heart using shapeshifting. So either way she is 1000x more likely to survive than PB.

    • 8 months ago
      Anonymous

      We must have a F&C related kagurabachi meme.

    • 8 months ago
      Anonymous

      Finn, Jake, and BMO wrapped up in blankets and drinking hot coco

    • 8 months ago
      Anonymous

      Hey since recent posts
      I think you should draw hudson, simon and VK strolling down the kane with child marceline
      The three of them are wearing sunglasses and "cool dad" shirts
      Hudson and Simon on the sides holding marcy's hands and VK on the back all smiles

      • 8 months ago
        Anonymous

        Pretend i'm not moronic and typed "down the lane"

        • 8 months ago
          Anonymous

          I read that as Stroking the kane at first..

    • 8 months ago
      Anonymous

      Minerva attempting to reach a fuzzy memory of the child she lost to the sea thousands of years ago on a dead world. Her body has experienced many transformations, as a result of her software being overwritten and multiple hardware malfunctions. Her human utopia is now a ruin. Little robots scatter about attempting to rebuild it. Sometimes they reflect their maker's shattered mind and paint, sculpt, and fabricate images of a small baby child long dead.

  65. 8 months ago
    Anonymous

    Why go through so much effort in showing her body?
    I think Huntress is going to make it out alive

    • 8 months ago
      Anonymous

      Why is she tanned?

      • 8 months ago
        Anonymous

        She constantly shown herself in UV lights while she was sleeping to deter vampires.

    • 8 months ago
      Anonymous

      A hunter knows how to survive any situation, she played dead. Also why isn't she magic?

      • 8 months ago
        Anonymous

        Not enough trees and plants in that world

        • 8 months ago
          Anonymous

          Is that really how her powers work I'd assume she had the ability to grow more. Weird plant/earth isn't an element but I'm sure that's just too basic for AT.

          What if he knows and is contemplating what best to do to her?

          That'd be funny it reminds me of a youtube vid where a guy was pretending to be sleep as he got robbed kek. Imagine him staring and her just sweating and whimpering trying to hold it together poor Huntress got involved in a dumbass plan.

      • 8 months ago
        Anonymous

        What if he knows and is contemplating what best to do to her?

    • 8 months ago
      Anonymous

      If they ever make a sequel to The Star it will involve having Huntress being reborn by a magic forest creature. Giving a pseudo backstory for Huntress Wizard.

    • 8 months ago
      Anonymous

      I’d love it if she wasn’t dead but they haven’t been holding back with showing off corpses

    • 8 months ago
      Anonymous

      Turned Huntress vs grown up Finn let's gooo.
      I mean if dyke fanbase got hatesex bait, why can't we.

      • 8 months ago
        Anonymous

        damn that sounds hot

        • 8 months ago
          Anonymous

          More vamp Huntress and with her teasing Finn

    • 8 months ago
      Anonymous

      Just wishful thinking but a sequel to the Star where a grown up baby Finn fight vampires and it’s reveal that Huntress is still alive but was turned into a vampire by VK as a replacement daughter for Marceline after believing she was killed.
      >imagine the hate love relationship with Finn and Huntress.

  66. 8 months ago
    Anonymous
  67. 8 months ago
    Anonymous

    everyone forgets that marcy has green eyes

    • 8 months ago
      Anonymous

      Yeah no one ever pays attention to that they're just programmed to think vampire=red. I was pleased to see that the boarders/artists remembered that and showed it in the Star episode.
      That goes all the way back to when Marceline first ever appeared.

  68. 8 months ago
    Anonymous

    I like these gals

  69. 8 months ago
    Anonymous

    >show ends in like 3 days
    lads what am I supposed to do now

    • 8 months ago
      Anonymous

      Enjoy the time left

    • 8 months ago
      Anonymous

      Thirst for VK, complain about bubbleline, compare and rank all the Finns, go on schizo rants about minor details only you noticed about the show, call lich a cuck uhh idk the possibilities are endless

    • 8 months ago
      Anonymous

      Write lots of fanfiction because you're mad about all the missed potential

    • 8 months ago
      Anonymous

      I don’t know, im running out of fantasy anime too im looking forward to frieren and goblin slayer and a few other shows but the world of adventure time is 100 times more fun and creative than even my favorite fantasy anime, all you can do is cope until the next mini series

  70. 8 months ago
    Anonymous

    What do you think Marcy and PB are up to during Shermy and Beth's era?

    • 8 months ago
      Anonymous

      being boring gays like they are any other time

    • 8 months ago
      Anonymous

      What if its Simon?

      • 8 months ago
        Anonymous

        The duck thing first appeared in Marcy's debut episode and the telescope has her initials (M.A.) on them

        • 8 months ago
          Anonymous

          I know. I'm just expecting the unexpected.

    • 8 months ago
      Anonymous

      Patience trying to do her shit again probably
      While the endless decline of time finally saps the pep out the princess

      • 8 months ago
        Anonymous

        I feel like Patience would look at 1000+ Ooo and just go back to sleep.

      • 8 months ago
        Anonymous

        I feel like Patience would look at 1000+ Ooo and just go back to sleep.

        You can actually still see her ice sphere in the intro so she's still frozen

        • 8 months ago
          Anonymous

          Man I love that intro. So many details.

    • 8 months ago
      Anonymous

      I would hope they do justice to the concept of two teens that have been now been alive for around two milleniums. Get some unsettling mannerisms and perspectives in their personalities born of entropy and repeated loss, instead of the usual “hey dood” cadence of most AT characters. PB can already be freaky but she can be worse

      But yeah I’m pretty sure her plans are to expand the CK into space, was that mentioned in the show or am I imagining it

      • 8 months ago
        Anonymous

        It was but she stopped once tt told her she was harming aliens
        I think her plan was to keep candy people safe
        And with the help of aunt lolly she build the new gumball guardian
        Lolly is in charge while she tries to aid marceline to find PB who was kidnapped by the Ice Thing(who started to kidnap people once it realised it was a thing Ice King did) while also having to keep everyone safe from gibbon the dictator pup

      • 8 months ago
        Anonymous

        It was but she stopped once tt told her she was harming aliens
        I think her plan was to keep candy people safe
        And with the help of aunt lolly she build the new gumball guardian
        Lolly is in charge while she tries to aid marceline to find PB who was kidnapped by the Ice Thing(who started to kidnap people once it realised it was a thing Ice King did) while also having to keep everyone safe from gibbon the dictator pup

        PB is no longer the ruler of the Candy Kingdom by Together Again and it's implied that the humans and candy kingdom merged into a city that eventually fell into ruin

        • 8 months ago
          Anonymous

          I didnt watch together again or obsidian or whatever other ones there were
          So i got a whole lot of junk just not in my brain

          • 8 months ago
            Anonymous

            Highly recommend at least watching Together Again. It's the real Adventure Time finale, very good.

            • 8 months ago
              Anonymous

              Honwstly sounds like the right thing to do before fionna and cake end so
              Alrighto! I will anon! Get back to you next thread when i randomly bring it up!

        • 8 months ago
          Anonymous

          > the humans and candy kingdom merged into a city that eventually fell into ruin
          I warned you about globalization, PB. I warned you gob

  71. 8 months ago
    Anonymous

    hey what kind of vampire is marceline. is she a toreador or a ventrue or some sort tzimisce, like what

    • 8 months ago
      Anonymous

      She is a soul sucking demon who got bit by the vampire king
      Making her the vampire queen
      She basically has every vampire powers and weaknesses AND her dad's soul related powers but that's about it

      • 8 months ago
        Anonymous

        She can also play the bass

    • 8 months ago
      Anonymous

      She diablerized like a dozen vampires at this point.
      Probably more of a Toreador tho.

  72. 8 months ago
    Anonymous

    Turned AU Betty trying to entrap Simon. That would be an interesting interaction.

  73. 8 months ago
    Anonymous
  74. 8 months ago
    Anonymous

    did you do that?

  75. 8 months ago
    Anonymous

    Where’s Hudson in vampworld? Is he proud of Marcy, maybe jealous that she’s thriving under VK’s empire instead of his?

  76. 8 months ago
    Anonymous

    Is he dead?

    • 8 months ago
      Anonymous

      No, he's coming back in the finale along with baby Finn, Prime Finn, and Fionna, and they will slay the Lich with their combined strength like in my favourite animes.

    • 8 months ago
      Anonymous

      Thats a vampire resistant hat so theres a chance that it was able to save him from those but most likely dead.

      • 8 months ago
        Anonymous

        Both are piercing attacks so you may be right

    • 8 months ago
      Anonymous

      Nah, they haven't shied away from showing blood. I think they left it ambiguous on purpose so that someone later can decide if he died or not.

  77. 8 months ago
    Anonymous

    Here's the compilation of PB and Human History Green texts

    • 8 months ago
      Anonymous

      Bless you. I was the anon who brought up Mengele because I kept imagining a tube with twin peppermint butlers and was wondering how to fit that into the gag.

  78. 8 months ago
    Anonymous

    Simon isn't beating the groomer/cradle robber allegations

    • 8 months ago
      Anonymous

      >Fionna: Simon! This is bad we had to leave this universe NOW!
      >Simon: Oh come on, Fionna. Whatever it is I'm sure we can get thru it if we just tal--
      >Cake: THE DISCORD SERVER MESSAGES GOT LEAKED!!
      >Simon: we must find and put on my insanity defense crown now!

      • 8 months ago
        Anonymous

        kek him using his crown as a defense is funny especially since ice king canonlogically declined dating a underage PB.

        >Cake:How bad could they be guys? Guys?
        >*fionna and Simon look at each other nervously drenched in sweat*

  79. 8 months ago
    Anonymous

    Does he at least frick fionna or betty?

  80. 8 months ago
    Anonymous

    plebbit has some good schizo theory crafting

    • 8 months ago
      Anonymous

      The frick am I reading?

    • 8 months ago
      Anonymous

      they just posted this on Reddit with no elaboration. kinda love that

    • 8 months ago
      Anonymous

      Not too far off.

      The frick am I reading?

      They are trying to predict that the next episode will feature prismo & scarab's boss. The being opposite of golb, the god of order. They are showing some hints sprinkled in around the show.

      • 8 months ago
        Anonymous

        Okay looking at this more I think I kinda get what they're showing a little bit. Mostly seems to be connecting Golb to whatever destroyed the area around the time room. And painting Simon & Betty's journey as a mirror of what happened to Magic Man and Margles. But that picture of a hand at the end is actually pretty interesting, it looks like the same portal Golb came from but it's in Simon's book about Golb.

        The user is saying that the whole thing might be a timeloop that may be finally closed off by the time of Fionna and Cake

    • 8 months ago
      Anonymous

      All cool but what exactly is the theory
      Satan and two of pents imagery means what?

    • 8 months ago
      Anonymous

      Okay looking at this more I think I kinda get what they're showing a little bit. Mostly seems to be connecting Golb to whatever destroyed the area around the time room. And painting Simon & Betty's journey as a mirror of what happened to Magic Man and Margles. But that picture of a hand at the end is actually pretty interesting, it looks like the same portal Golb came from but it's in Simon's book about Golb.

    • 8 months ago
      Anonymous

      o yes I love a little Gnosticism in my sadboi cartoons.

    • 8 months ago
      Anonymous

      Time is a flat circle is it not?

    • 8 months ago
      Anonymous

      The frick am I reading?

      they just posted this on Reddit with no elaboration. kinda love that

      All cool but what exactly is the theory
      Satan and two of pents imagery means what?

      It's reliant on Gnosticism but it's a good take. Years ago people pointed out that in the occult book (which seems to be AT's version of the Lesser Key of Solomon or something akin to that) you can see an entity in the left page next to Golb's page. It's name is Malus and other users pointed out that it looked like Abraxas, a god in Gnostic literature. It's also an ancient latin pronunciation found on late Greco-Roman charms. It has a lot of meanings, but for the purpose of representing Simon, I believe Jung's (psychoanalyst) interpretation reigns supreme: Abraxas represents the driving force of individuation (making things distinct). Making things have a sense of synthesis, maturity, oneness.

      I believe the poster paralleled Malus and Golb to Simon and Betty, the latter literally being a part of Golb, and how it's seen as a cosmic balancing act. The infinite snake below it is the Ouroboros. This, along with the way the OP parsed Tart Toter's cryptic message leads me to believe that Simon and Betty are about to finalize the creation of an infinite loop through their desire for one another. Both cannot move on from one another on a cosmic level and are doomed to repeat this cosmic dance ad infinitum.

      TL;DR: It's implied Simon and Betty were meant to keep a perpetual time loop. Their tragedy is an all-consuming, self-creating dance. Showrunners have already presented chinks and flaws to their relationship and perhaps this foreshadows how this cosmic dance is toxic to the overall multiverse.

      Skipping a lot of reading material from associated esoterica here and going off some of his comments. It's foreshadowed when Prismo talks about the The Time Core where the Clock Titans hit eachother to create time waves, which presumably keep time and space in motion.

      • 8 months ago
        Anonymous

        Thank you for explaining this for everyone. I thought about posting something similar.

        • 8 months ago
          Anonymous

          Can someone link to the original reddit post?

      • 8 months ago
        Anonymous

        You know in most shows I'd say this level of theory crafting and symbolism is too much. But the AT people are actually schizo enough to think about this stuff.

      • 8 months ago
        Anonymous

        Thanks for this. It's very interesting. It lines up with the description for the next episode that says Simon will travel through time. Does he go back and give himself the crown? A lot to think about.

        • 8 months ago
          Anonymous

          You know in most shows I'd say this level of theory crafting and symbolism is too much. But the AT people are actually schizo enough to think about this stuff.

          Thank you for explaining this for everyone. I thought about posting something similar.

          https://www.reddit.com/r/adventuretime/comments/16r8qg6/addressing_the_larger_backplot_that_has_only_been/

          Original post. Can scroll through his history for more info as he probably has a better grasp at other extent references I didn't catch up on.

          I was just really interested in Malus the first time they showed him. It made sure to show the viewer they took from Hermetic text as reference material.

          • 8 months ago
            Anonymous

            Remember that Tart Toter is a gingerbread man and there is a lot of Gingerbread men imagery in the show.

            • 8 months ago
              Anonymous

              this entire show is just a perpetual soup (heh, get it?) of different writers adding onto old things. I'm just glad someone down the line was either a schizo, an occult practitioner, or just thought esoteric books would look cool aesthetically. either way I'm activated now.

              I wonder if they'll reference his speech in the final two eps. It definitely had it's own self contained meaning in that episode where people kept fricking robbing the guy, but I mean now that I saw a schizo rant on it...

              • 8 months ago
                Anonymous

                As a guy that is into the occult, and esoteric knowledge, I look at the show as a secret love to esoteric belief, Jungian thought, and ancient European Epics.

                The world Ooo and the inhabitants is a blatantly inspired by Hieronymus Bosch and other medieval surrealist painters.

              • 8 months ago
                Anonymous

                >gardenofearthlydelight-pilled
                where would you put bubbleline in this portrait?

              • 8 months ago
                Anonymous

                Of course to the right. That is the best part of the triptych.

        • 8 months ago
          Anonymous

          honestly that wouldn't be a stretch. I think something bad might actually happen to Simon if that tweet hyping up the sadness in the next eps is to be taken at face value.

        • 8 months ago
          Anonymous

          oh man if it all comes back around and the simon in the intro flying through the void is something that happens diagetically in like the last episode I am going to lose my mind

      • 8 months ago
        Anonymous

        Sorry I meant to say "It's implied Simon and Betty were meant to keep a perpetual time loop OR it's a self-perpetuating anomaly that traps the cosmos and time in a loop."

        Furthermore, I think Simon being represented by AT's Abraxas is apt. Abraxas is the synthesis of truth and lying, dark and light, it is the demiurge in Jung's myth. It is the manifestation of Pleroma (fullness of divine power, the fullness of the Godhead). When you think about that homosexual gay YA novel going on in Simon's head, you think of them as living within Simon, being wholly connected to Simon to the point where whatever he does changes that world. AT Abraxas can also take on the meaning of synthesizing both Simon and Betty into the loop, as Abraxas himself is defined as being a "wholeness" to Golb-betty's "chaos" or "unreality."

        >Immeasurable, like the host of stars, is the number of gods and devils. Every star is a god, and every space occupied by a star is a devil. And the emptiness of the whole is the Pleroma. The activity of the whole is Abraxas; only the unreal opposes him.

        Fionna and Cake are implied to be the only thing that can stop the loop through their negation of magical properties.

      • 8 months ago
        Anonymous

        So if Simon is Abraxas/Malus, who is Golb/Betty again?

        • 8 months ago
          Anonymous

          just Golb. I don't know if there's a good parallel for Golb outside of Azathoth.

          • 8 months ago
            Anonymous

            There's a Mario question block inside Golb's head, what's in it

            • 8 months ago
              Anonymous

              I think some speculated that the block was Prismo's house but not sure.

          • 8 months ago
            Anonymous

            Golb is possibly a parallel to yaldabaoth

            • 8 months ago
              Anonymous

              I'm moronic, yeah good point!

              • 8 months ago
                Anonymous

                Because I'm still working in a way to get the frick out.

          • 8 months ago
            Anonymous

            From the wiki
            >GOLB is similar to the Zoroastrian anti-god Angra Mainyu in that he is a deity-like figure (as opposed to the Satan-like Lich) symbolizing evil and chaos as well as essentially idiotic. Both entities are curiously similar in that the protagonists retrieve loved ones from their bowels: in Zoroastrian myth, Jamshid inserts his fist in Angra Mainyu's anus to retrieve his brother while Jake takes advantage of "Time Adventure" to free Finn, Simon and Betty from GOLB's stomach.

  81. 8 months ago
    Anonymous

    I wonder what this timeline was

    With Jake being weirdly winded I have to wonder if this is prime timeline before he dies, but Finn looks bigger than he did in Obsidian

    • 8 months ago
      Anonymous

      It's before obsidian atleast bc Jake's still alive

      • 8 months ago
        Anonymous

        That’s what I mean, is it prime timeline pre-Jakedeath or is it an alternate wished timeline where he doesn’t die?
        I was kind of assuming the latter before but it’s probably the former

        • 8 months ago
          Anonymous

          It's OG Jake bc prismo refers to it as the dimension with his" favorite guy"

          • 8 months ago
            Anonymous

            Why doesnt prismo just talks with the numerous other jakes from universes that are basically copies of the og universe where jake would know about prismo and didnt die yet or whatever

            • 8 months ago
              Anonymous

              OG Jake was the only Jake that interacted with him/gang out with

  82. 8 months ago
    Anonymous

    Adventure Time is just becoming the adventures of a middle aged museum conservator fighting is mental illness.

  83. 8 months ago
    Anonymous

    Frick this is creepy

    • 8 months ago
      Anonymous

      The Lich really gives off "analog horror" vibes. LIke you know he knows you are looking at him.

      Also the TV static really makes it unnerving.

      • 8 months ago
        Anonymous

        I hate that he is smiling.
        When the lich smiles is because he is cooking up a plan.
        I wonder what happened in that dimension after this scene

  84. 8 months ago
    Anonymous

    Stupid theory but what if Scarab becomes Golb, or Glob, or both? He's red and angular. That's all I got.

    • 8 months ago
      Anonymous

      Glob is definitely his boss but otherwise idk

      • 8 months ago
        Anonymous

        actually nvm, Glob died, right?

        • 8 months ago
          Anonymous

          Glob died
          You thinking of golb

          • 8 months ago
            Anonymous

            I don't think Golb is Scarab's boss

            • 8 months ago
              Anonymous

              Yeah but the other anon was probably confusing golb with glob

  85. 8 months ago
    Anonymous

    Were Prismo and Scabby exes?

  86. 8 months ago
    Anonymous

    >please don't let the f&c finale be as bad and rushed like the adventure time finale
    please don't let the fionna and cake finale be as bad and rushed like the adventure time finale
    >please don't let the f&c finale be as bad and rushed like the adventure time finale
    please don't let the fionna and cake finale be as bad and rushed like the adventure time finale

    • 8 months ago
      Anonymous

      You'll get what you wished for but the final episode ends on a cliffhanger

      • 8 months ago
        Anonymous

        >cliffhanger

        I hope not

  87. 8 months ago
    Anonymous

    >Simon’s reason to live after losing his world and his Betty was drying a little girl’s tears and protecting her
    >He had to leave when he started making her frown
    >Current Simon is again finding himself making a little girl frown (the FnC fangirl)
    >Even without the crown he’s losing himself
    >He’s at the end of his rope and remembers the feeling of being needed and making a girl happy
    >But Marcy isn’t a little girl anymore and she’s already happy
    >Confiding in her would just deafeat the purpose of what he’s looking for; making her worried would just make him feel worse
    >Finally along comes another you girl crying and needing his help
    >so he resolves to do the same thing he did for Marcy - wear the crown
    >but Marcy never liked that, it never made her happy
    >and it will be the same for Fionna, but hopefully this time the girl can succeed in staying his hand

    • 8 months ago
      Anonymous

      >Little girl
      The b***h is at least 25

      but yeah realy Simon is a real Dadfu, my guy see a young or emotionally unstable girl in distress or need of guidance and will literally commit suicide/ego death to save them. He's really a bit too loving in a way.

      • 8 months ago
        Anonymous

        Fionna is so immature that she's practically a child.

        • 8 months ago
          Anonymous

          True she really is. I get being a failure and bad at "adulting" but for her being in her late 20s super early thirties it's insane. I'm younger than her and have my life put together better and I post on Cinemaphile

          Fionna is a 30yo failure to launch millennial.

          Lol never heard that phrase before but yeah basically. When the show started I genuinely thought she was like 19-22 but her being a full ass adult is insane. Like her room, her just quitting her job and being such a prick and schizo before life humbled her.

          • 8 months ago
            Anonymous

            Tbf she is immature because she got sent into a magic world and feels like she is young and adventurous magic in it
            In the normal world she was just a regular loser but still had priorities and attempts

            • 8 months ago
              Anonymous

              I mean my brother in Cinemaphile she literally stripped in public, and also had a semi mental break down over her dream at work. Like she really was always a bit of a childish tard if anything I could excuse her power fantasy bs if in the real world she wasn't also a bit of a prick to others around her at times.

              • 8 months ago
                Anonymous

                Okay you got me there.
                Her ultimate downfall is that she got sent to 16+ Ooo instead of E for everyone Ooo so she cant just goof around like finn and jake used to

              • 8 months ago
                Anonymous

                True, also really maybe the joke was girls and cats just suck lol. I feel Cake is a lot more aggressive and schizo than Jake ever was she's well meaning but like a cat she just fricks shit up and is a bit petty. Then fionna was on a power trip so they just both kind of were already not ready for ew. Probably even in F+J ooo they'd have gotten fricked up.

                >Now all I see is a young finn and jake beating up fionna and cake for causing trouble.

                Her room and the first intro song just makes me think she has actual depression or some similar severe-lows causing disorder

                True, it's basically in the song as it's all about not feeling like ones self also based on all the outfits and references to her losing jobs. she basically hates the grind of having a job she's not interested in and then eventually fails out. Same with how she talks about feeling motivated or like herself of course it is a bit strange only fionna experiences this since everyone else were also magic but seem fine and happy.

              • 8 months ago
                Anonymous

                >it is a bit strange only fionna experiences this since everyone else were also magic but seem fine and happy.
                Cake is ornery and trying to escape the world while she's just a normal cat.
                I think they're affected because they're the protagonists of the story that's trapped in Simon's mind.

              • 8 months ago
                Anonymous

                True I barely counted cake as it seemed less like she felt wrong and more she could see the small distortions that occurred when Simon used the spell. Either way that is a interesting take but yeah if you were the mc of a story and then were forced to be the town b***h you'd probably be suicidal and pathetic too. I mean she's like just a odd job taking cringefail loser girl

              • 8 months ago
                Anonymous

                Her room and the first intro song just makes me think she has actual depression or some similar severe-lows causing disorder

              • 8 months ago
                Anonymous

                Major depressive disorder (MDD) Not holding a job is a sign of MDD. Also her sporadic actions and anxiety are also symptoms.

          • 8 months ago
            Anonymous

            Well aren’t you a good lad
            Aimlessness is an epidemic that affects many of your peers and seniors. Always did, frankly.
            But back in the day people would embrace the gutter and become a full fledged loser instead of pretending like they’re trying

          • 8 months ago
            Anonymous

            People did suspect that the reason Fionna is so immature is because Prismo just switched over things without making the proper nuanced changes. Finn was like fourteen yet Prismo made Fionna like eighteen or whatever. That's not even mentioning the whole change of a non magical world either.

            I just don't understand why we have to force homosexuals into every piece of media? Why can't homosexuals just pretend to be normal people in public, then do their disgusting nasty homosexual shit at home where no one can see them just like the regular heterosexual degenerates do? Homosexuality is like the same thing as having a really disgusting fetish like gaping or scat. It's the same energy. So why do they have to be all proud of it and shit?
            You don't see these other bizarre fetishes in cartoons. It's like how there were so many weird foot fetishes in old cartoons, too, and no one fricking liked that shit, but the producers put it in there anyway. Is it the same thing with homosexuals and dikes? God I hate it so much.

            Just keep your fricking fetishes behind closed doors and pretend they don't exist like all the other degenerates in the world.

            Dude calm down. Go to /misc/ or something. You're just being obscenely mad over a cartoon to people who don't really care about that sort of thing. Read a book or something.

            • 8 months ago
              Anonymous

              A. true you are right but I think with her growing she's proving she had the ability to grow just never the reason. Sometimes trapped in your bubble you can become stagnant even if growth is the only way to break out, it's how hermits and neets and incels happen they need to take that first step but never do then just get worse.

              B. don't give them (yous) anon it's what they want

        • 8 months ago
          Anonymous

          That's pretty much modern women in a nutshell.

      • 8 months ago
        Anonymous

        Fionna is a 30yo failure to launch millennial.

  88. 8 months ago
    Anonymous

    I hate gays so much it's unreal.
    I hate gay/lesbian homosexuals, and I hate that they insert their fricking moronic aberrant degeneracy into cartoons and shows that I like. I hate that every show made for LITTLE KIDS has fricking homosexualS in it! I hate gay people who put their dicks into other man's buttholes! It's dirty and it's disgusting! I'm tired of pretending it's normal when it's not!
    STOP TRYING TO NORMALIZE BEING A DEGENERATE! STOP TRYING TO NORMALIZE ABERRANT BEHAVIOR! STOP PUTTING gayS IN CARTOONS!

    • 8 months ago
      Anonymous

      I hate you and your moldy thoughts

      • 8 months ago
        Anonymous

        Amon brother!
        You down for gay VK-posting later?

        • 8 months ago
          Anonymous

          VK-posting is actually funny as frick.

          • 8 months ago
            Anonymous

            Real

    • 8 months ago
      Anonymous

      kissu

      • 8 months ago
        Anonymous

        Kissing another man is fricking disgusting btw
        actually sickening to see. When I see it in public, I actually wretch. No exaggeration, it's disgusting.

        • 8 months ago
          Anonymous

          *Malepregs you*

        • 8 months ago
          Anonymous

          < One time I say a gay in public, I literally wretched and shit my pants. I filled my pants with shit because of all the gayhomos.

      • 8 months ago
        Anonymous
      • 8 months ago
        Anonymous

        People always say frick in the elevator, but I ask: How is it possible to frick in an elevator? You'll only have a few seconds to do it?

        • 8 months ago
          Anonymous

          You eont frick in them you just make out there
          Tho you can just hit all the buttons

    • 8 months ago
      Anonymous

      can shut up or at least post some VK with your rant

    • 8 months ago
      Anonymous
  89. 8 months ago
    Anonymous

    PB and Marcy were canonically normal people before the writers turned them into homosexuals, and now this whole fandom is full of homosexuals and queers. I hate it so much. Why does every character have to be a fricking gay? I could understand if there was like, one gay couple in the show, but why is EVERY CHARACTER GAY OR BI???
    If adventure time were releasing for the first time now, Jake would have been a wienersucker, Finn would have been a bisexual (AKA a fence sitting wienersucker) and the show would have been absolute SHIT

    • 8 months ago
      Anonymous

      >PB and Marcy were canonically normal people before the writers turned them into homosexuals, and now this whole fandom is full of homosexuals and queers. I hate it so much. Why does every character have to be a fricking gay?
      This is the brave new world where everyone and everything is at least in some way part of the LGBTQIA+2S spectrum.

      • 8 months ago
        Anonymous

        LG TV

    • 8 months ago
      Anonymous

      Name the gay characters that arent BP and marcy and that have a importance to the plot and overall show both by being theyre and by being gay

      P.S. my captcha is "GAYVX" which is ironic

    • 8 months ago
      Anonymous

      This. Subhuman writers make super hot girls into lesbians. Yang, Marceline for example.
      Best and beautiful girls supposed to end up with handsome main characters.

      • 8 months ago
        Anonymous

        Meh. This trend'll pass soon enough I think.
        Let homosexuals and troons have their fun for now. Their lives in most cases are fricking pathetic, so seeing degenerates like themselves in cartoons is one of the few joyful things in their sad, miserable existence.

  90. 8 months ago
    Anonymous

    Mad science princess made of candy and demon ultra vampire rockstar, yeah we all know those kind of normalgays

  91. 8 months ago
    Anonymous

    I would have liked to see more of this team

    • 8 months ago
      Anonymous

      Same.

  92. 8 months ago
    Anonymous

    I just don't understand why we have to force homosexuals into every piece of media? Why can't homosexuals just pretend to be normal people in public, then do their disgusting nasty homosexual shit at home where no one can see them just like the regular heterosexual degenerates do? Homosexuality is like the same thing as having a really disgusting fetish like gaping or scat. It's the same energy. So why do they have to be all proud of it and shit?
    You don't see these other bizarre fetishes in cartoons. It's like how there were so many weird foot fetishes in old cartoons, too, and no one fricking liked that shit, but the producers put it in there anyway. Is it the same thing with homosexuals and dikes? God I hate it so much.

    Just keep your fricking fetishes behind closed doors and pretend they don't exist like all the other degenerates in the world.

    • 8 months ago
      Anonymous

      I get it.

      It is going to get worse and there is nothing you can do about it unfortunately.... Welcome to the future.

    • 8 months ago
      Anonymous

      Cease

    • 8 months ago
      Anonymous

      okay buddy the bit it running dry.

    • 8 months ago
      Anonymous

      >It's the same energy.
      To you because you keep shitting in your brain
      Cleanse yourself of dirty bias and actually get to know some people and their feelings

      • 8 months ago
        Anonymous

        No, this is why I say this, because I know gay people IRL. Lots of them. I use to live in Seattle FFS and before that I lived in PORTLAND so I've known MANY MANY gayS

    • 8 months ago
      Anonymous

      The majority of people here only care about bubbline cause of the porn

  93. 8 months ago
    Anonymous

    Enough of 'is fionna a virgin'....
    Is cake a virgin?Is she neutered?

    • 8 months ago
      Anonymous

      Prismo undid the neutering so she may have her freak Monochromicorn-Cat offspring

  94. 8 months ago
    Anonymous

    I really hope by the end of the series Fionna becomes more like Finn. Selfless, kind and brave.
    What they're doing with her is interesting, but so far she isn't much of hero I don't think. Which just doesn't sit right with me.

    • 8 months ago
      Anonymous

      She's just a lamer version of Finn, which makes sense since she was raised in a normal mundane environment unlike Finn.

      • 8 months ago
        Anonymous

        Yeah. Imagine how great it will be to see her change into a hero like Finn.
        Heroes aren't born heroes after all. You have to become one.

    • 8 months ago
      Anonymous

      I think she’s been showing plenty of those qualities, but she also gets scared like how Finn could when he got over his head occasionally. Jake was always there to pull him out of winless situations and that gave him confidence as well. And she and Cake can have the “frick your shit let’s have fun” mentality that FnJ did at times too

      I see her cowering here and there after getting herself into shit and I see a Finn that would do the same if he had no experience with fighting. And more than anything I see the similarity in beating themselves up after realizing their behaviour is fricking everything up.
      But yeah I want to see where she goes. I really would like a S2 that keeps following her, I’ve grown to like her and Cake. I’d also like to see more of Finn and Jake, a team up would be unfathomably based

      • 8 months ago
        Anonymous

        Agreed. Team up would be cool to see.
        What separates the two (Finn and Fionna) is Fionna's lack of willpower compared to Finn. Finn is fricking relentless, unstoppable when he sets the goal for himself. Which is a main quality that makes him a "hero" guy in our case. And why he's so likable and inspiring.
        While Fionna is... well she got absolutely no confidence. The fact that Cake, unlike Jake, provides much less emotional support doesn't help.
        That's why I'm very interested in where this all will go in the end. So far Fionna and Cake are nothing like Finn and Jake, which does make them different and it's good, but... I'd honestly like them to become MORE like our OG team. With their own faults and characterisation, but heroes nonetheless.
        That's also why I think Simon's going to be alright. What better way to show Fionna finally getting a hold of herself, than saving a day in the end?

      • 8 months ago
        Anonymous

        Thing is, Finn had Jake who despite certain moments across AT was a generally good role model and like a big brother for Finn. Cake in the other hand is dumb, selfish and a genuinely bad person.

        • 8 months ago
          Anonymous

          Jake was Finn's big brother and also a dog, Cake was just Fionna's pet and a cat who are selfish greedy creatures.

  95. 8 months ago
    Anonymous

    Do you ever wish your girlfriend would do this to you?

    • 8 months ago
      Anonymous

      >2012
      >Finn is literally me.
      >2023
      >Simon is literally me.

      • 8 months ago
        Anonymous

        >2023
        >be loner, laughed at by peers
        >skinny with brown hair like Simon
        >half-slav, probably Turkish as well
        >read nag hammadi, Hermetic Philosophy and Creative Alchemy, countless /x/ recommended book lists
        >develop disdain for plebs
        >tries to manifest cute redhead gf who likes my autistic hobbies
        >cries in shower when I have to take meds
        He's literally me fr fr. why am I so alone bros...

        • 8 months ago
          Anonymous

          Simon actually scored

          • 8 months ago
            Anonymous

            AAAAAAAA

        • 8 months ago
          Anonymous

          Should had tried some other thing, anything but hemertism or alchemy for that one, pal. I know shit about hermeticism, only that is used by all the frumpy preppy ass motherfrickers of the right pillar.

          I know my shit through my own head, not from books. Instinctually and such, my methods are chaotic but they work well, when they work, I'm sure you heard of my type at some point.

          I'm pretty sure hermerstism is used more to achieve balance and reject the mundane desires like this ones, so it kinda makes sense it never worked. Alchemy, for I understand now has less to do with what people think it is and more to now with the relation between the metaphysical and the physical, right? Something like that, the path between the astral and the mundane is ether.

          You want some cute gf, try the path of the triple goddess with some tang of the dancing goddess. It should work, I think, at least is what my instincts are telling me. They are also telling me is a terrible idea, so you know...

          • 8 months ago
            Anonymous

            I tried that but the cute wiccan goth chick who sells exotic soaps said she couldn't vibe with my chakras.

            I wanna be Simon so bad but best I can do is a depowered Ice King.

            • 8 months ago
              Anonymous

              Don't...Don't really interact with women about this sort of stuff. Seriously, a lot of them just use as fashion. I don't have access to any of that since I live in the middle of nowhere, I spend weeks memeing like a moron in a discord group full of women to parasite some of their energy using my own methodology to see if I could will one lady that knew some wicca in to existence, and the moment I got one to help me with my shit she complete panicked and left me hanging because "my bad energy". Is all bullshit, anyway, b***h calling me a incubus when I can't even get laid. I swear to god.

              And you know, you really don't need a girl to do that, you are technically a girl. just do some research on Anima and animus. Some lucid dreaming and you using it as a portal for the more intimate parts of your subconscious and you actually convincing your feminine part to help you. two years or so I think, I've been trying to the lucid dreaming part but is not exactly easy. I'm taking a lot of creative liberties here btw, so I don't really guarantee anything.

              • 8 months ago
                Anonymous

                what do your tarot cards say about the last 2 eps?

              • 8 months ago
                Anonymous

                I have no fricking idea. My grandma played with tarot but she was a total scammer doing hot reading and such. My aunt was a psychic that heard things from static from radios and was pretty famous. I'm pretty sure it was just pareidolia enhanced by female hysteria, but I can check out some youtube static to see if I can listen to something, but I also don't guarantee anything. This sort of thing works much much better with a ritual involved and made sure the ritual was not tainted by a skewed by normies in to stupidity. If you pay the price to make my time worth it.

        • 8 months ago
          Anonymous

          I personify with Simon because I have obscure esoteric interest and when I try to explain things to people its like talking to a child. I have to try to mimic others to try and get on their level. I have a hard time wanting to engage with other because it is like talking to npcs.

          I guess having a high IQ equal suffering..

          • 8 months ago
            Anonymous

            You’re smothering yourself in your ego. Blinding and deafening with you you you, you and your self-pity and your pride. Do you listen to others first? What is the connecting elements between you and another that will serve as a bridge for your ideas? Do you ask them what their ideas are? People are often hiding some surprises but the unsociable often give up hope because they don’t know how to dig past the surface of small talk or get another to feel comfortable and open up. And of course, are you just infodumping on them and expecting them to feel engaged by your slew of facts and theories that are born from other facts, despite them not having the experience you have had to spark interest? Are you good at replicating your experience for another? Are you an engaging speaker, do you have charisma? People usually aren’t prepared for the conversational equivalent of homework and will feel shut out and slighted if you start talking to them like a child. Yes they’ll encourage your dumping if they see you’re excited but that’s just politeness and kindness. You have to recognize when someone is actually in sync as opposed to just awkwardly holding the door for you.
            And intelligent people familiar with esoteric concepts are more common than you think, I have two bosses that love to yarn about such topics. Try to get yourself in environments where you’re likely to meet people who are educated or need to use their brains, (I don’t imagine the common living of Cinemaphile anons, greedy ego business or internet and loneliness poisoned IT is the type of intelligence that will have a growing effect on you)
            Humbleness is a mighty virtue that many on Cinemaphile forget. Because they are constantly counselled by the advice of the isolated. They truly start to believe that giving up belief in people’s humanity at the face of any difficulty in connecting to them, is a reasonable or beneficial action. We are the only motherfrickers with inner thought amirite…

            • 8 months ago
              Anonymous

              I'm charismatic, people like talking to me and I let them build a bridge of ideas. I have a habit of causing others to stop working and start following me, I try and take interest in what they want to share, but it is so vapid, immature, or just mundane...

              >People usually aren’t prepared for the conversational equivalent of homework and will feel shut out and slighted if you start talking to them like a child. Yes they’ll encourage your dumping if they see you’re excited but that’s just politeness and kindness. You have to recognize when someone is actually in sync as opposed to just awkwardly holding the door for you.

              you hit the nail on the head. I do recognize when other click with me but it is rare, that door is normally closed.

              It is hard to say, I blind myself with my ego and I tend to look down on others because I preserve them as empty people..

  96. 8 months ago
    Anonymous

    I love it. From gay vampire shit posts to a discussion about the secret gnostic symbolism in a cartoon.

    • 8 months ago
      Anonymous

      I can't wait for the massacre of AU Fionna and Cake world. They killed the immortal gameboy baby, they have no limits now.

  97. 8 months ago
    Anonymous

    >the show is now adult
    will there be a sex scene?If so who?

    • 8 months ago
      Anonymous

      20 minutes of hot, uninterrupted babymaking sex episode starring Finn and his wife Huntress Wizard.

      • 8 months ago
        Anonymous

        how does tree pussy feels like?Bark?

        • 8 months ago
          Anonymous

          I don't think he's going to sex her when she transforms into a tree. Sounds very unsafe. Splinters and stuff y'know.

          • 8 months ago
            Anonymous

            I mean she is practically a tree even in human form

        • 8 months ago
          Anonymous

          C̴̬͔̈́̓́̈́͘͝͠U̴̘̖̹̠̭̘̮͙̖͆̾͋̀̃̌͑͆̇̚M̴̧̢̰̻̙͙̳̬̪̜̥͈̟̬͚̓̀̂̆̍̐̚͘.̴͕̰̳̩̟̝̝̠͎͍̬̈͌̌̋̃̊͂͂͊̃̈́̀͘ͅ

        • 8 months ago
          Anonymous

          Well there was that one /k/ommando that fricked a tree.

  98. 8 months ago
    Anonymous

    STOP wanting to have sex with the fricking Lich
    Sex with Orgalorg instead

  99. 8 months ago
    Anonymous

    I too would love to die of dicky overdose

    • 8 months ago
      Anonymous

      only one of them can be classified as dicky and that's his daughter.

  100. 8 months ago
    Anonymous

    >watching the show
    >mom walks by
    >told me that simon is never gonna be happy
    >left
    >never talked about that anymore
    ???

    • 8 months ago
      Anonymous

      >hashtag relatable

      • 8 months ago
        Anonymous

        no

  101. 8 months ago
    Anonymous

    Simon is gonna GET LAID

    • 8 months ago
      Anonymous

      BASED

      • 8 months ago
        Anonymous

        LAID TO REST

    • 8 months ago
      Anonymous

      BY WHO

      • 8 months ago
        Anonymous

        BY ME

    • 8 months ago
      Anonymous

      I've been trying to Lucid dream as Fionna lately so that I can frick Simon in my dream while I am literally Fionna
      Simon will be laid, and I shall lay him, in my dreams, with my Fionna puss, and wake up with cum stained sheets, it shall happen

      • 8 months ago
        Anonymous

        you are more mentally ill than the troony fiona guy

        • 8 months ago
          Anonymous

          I don't want to become a woman, it's all just a dream anyways, it is over when I wake up and I gotta do the laundry ya know?

      • 8 months ago
        Anonymous

        How old are you again, anon?

      • 8 months ago
        Anonymous

        Hope you will do it femanon

  102. 8 months ago
    Anonymous

    So what are Golb and The Lich' relation to the ancient primordials that existed before nothing, are they above them, beneath them, or primordials themselves?

    • 8 months ago
      Anonymous

      is finn a prime more dial?

    • 8 months ago
      Anonymous

      I think the wiki said the lich is the embodiment of evil that land on earth billions of years ago from a comet and was awaken by the mushroom war.

      Finn is the embodiment of good and destined to fight the lich as his counterpart. So he is more a primordial force of the universe given an human form.

      I didn't watched the show this far, so I'm not sure how much this tracks, I was just checking some stuff unrelated to that. I'm not sure how this works with the scholar of golb thing simon said.

  103. 8 months ago
    Anonymous

    Is the Lich going to use the GOLB portal as a way to find more universes with life or was he just there to be a conduit to get out?

  104. 8 months ago
    Anonymous

    Hoping for polarizing kino.

    • 8 months ago
      Anonymous

      hot

  105. 8 months ago
    Anonymous

    [...]

    [...]

    [...]

    [...]

    [...]

    [...]

    what the frick is wrong with OP

    • 8 months ago
      Anonymous

      not him, but Adventure Time was truly a mistake

Leave a Reply to Anonymous Cancel reply

Your email address will not be published. Required fields are marked *